KEGG   Bacillus subtilis subsp. subtilis 168: BSU12520
Entry
BSU12520          CDS       T00010                                 

Gene name
xkdB
Definition
(RefSeq) phage-like element PBSX protein XkdB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_29 HTH_DeoR HTH_36 HTH_28 FaeA HTH_23 HTH_11 Rrf2 GntR HTH_Crp_2 HTH_17 Sigma70_r4_2 TrmB Phage_terminase PDT HTH_5 HTH_Tnp_ISL3 MarR_2
Other DBs
NCBI-GeneID: 939420
NCBI-ProteinID: NP_389134
Pasteur: BG10995
BSORF: BG10995
UniProt: P39781 A0A6M4JFB8
Position
1322014..1322850
AA seq 278 aa
MKNDKSYPFPTYSGLLNSEHYDKIGPALWLFLWFISSTTKEIEKDGVSWGIVLGHKPLKA
REMAAVFGVSEKTVRRWLELLENHDYIKAVRAPYGLMISVKHSKKFSFRSDNTVHGSLKE
RPFSPQTPDTNDRTDIDKTNKYTAADDAVDHIAKRFTQLRSAQEGRTVYPSSRDYQAIAR
IVAIGVPVTQTIKWLEECFQAFENRRTAASETIKAFRYCSKFIEDRFFAQQAKKNAAIQH
ERMKKHDKTNNRTDFGRAEKRETSITGGQTGRIRRKQV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaaaaacgataaaagctatccttttccgacgtattcagggttgttgaattcagaacat
tatgacaaaattggcccggcgttatggctgtttctctggtttatcagctcaacaacaaaa
gaaatcgaaaaagacggcgtaagctggggcatcgtactcggccataagccgttaaaagcg
agagaaatggcggcagtcttcggcgtaagtgaaaaaaccgtcagaagatggctggagctt
ctcgaaaaccatgattacataaaggccgtccgtgcgccatacggactgatgatttcggtc
aagcattcaaaaaaattcagcttcagatcggacaatactgtacacgggagtctaaaagaa
cggccattttcgccgcagacaccggacacaaacgaccgtacagatatagataaaacaaac
aaatatactgctgctgatgatgcagtggatcacattgcgaagcggtttacacaattacgg
tcggctcaagaaggacgcaccgtgtatccttcctcaagagattatcaagccatcgcccgc
attgttgccatcggcgttcctgtcacgcaaacaatcaaatggcttgaagaatgctttcag
gcttttgaaaaccggcggaccgccgcttctgaaacaatcaaggcttttcgctactgctcg
aaattcattgaagatcgatttttcgcgcagcaagccaaaaagaatgccgcaattcagcat
gagaggatgaaaaaacatgacaaaacgaacaatcgaacagattttggacgagctgagaag
agggagacgtccattactggcggacaaaccggccgaatcagacgcaagcaggtatga

DBGET integrated database retrieval system