KEGG   Bacillus subtilis subsp. subtilis 168: BSU12539
Entry
BSU12539          CDS       T00010                                 

Gene name
ykzK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8303179
NCBI-ProteinID: YP_003097712
UniProt: C0H3Z5 A0A6M3ZA29
Position
1323550..1323717
AA seq 55 aa
MCKLCQTKKVIVEHTGIGVVFHPCPNCRSGTDLTPVIQKLEQMLTAGKARLNIYD
NT seq 168 nt   +upstreamnt  +downstreamnt
atgtgtaagctttgtcaaacaaagaaagtcattgtggaacataccggtattggagttgtt
tttcatccatgtccgaactgccggtccggcactgacttaacgcctgtcattcaaaagctg
gagcaaatgctgacagcgggaaaagcgaggctgaatatctatgattaa

DBGET integrated database retrieval system