KEGG   Bacillus subtilis subsp. subtilis 168: BSU12540
Entry
BSU12540          CDS       T00010                                 

Gene name
xkdD
Definition
(RefSeq) phage-like element PBSX protein XkdD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 936466
NCBI-ProteinID: NP_389136
Pasteur: BG10997
BSORF: BG10997
UniProt: P39783 A0A6M4JHM3
Position
1323802..1324152
AA seq 116 aa
MKVLAKTKQAEKSPAPWRAVPCGDTKPIYIYSAYSEEEKERFPYSNGRLIAAVFDLSSYS
QKSNASLMAAAPELLEASKAALDFLKGNSIHSKERIIQLLEKAEASAAPKRGGNKT
NT seq 351 nt   +upstreamnt  +downstreamnt
gtgaaagtgttggcaaagacaaaacaggcagagaaaagccctgcgccgtggcgtgctgtc
ccgtgcggggatacgaaaccgatctatatttattcagcttacagtgaagaagaaaaagaa
agatttccgtactcaaacgggcggctgattgcagctgtatttgacctcagctcttattcg
caaaaaagcaatgcctctttgatggccgctgcgcctgaattgctggaagcgtctaaagca
gcacttgattttctgaaagggaattctattcattcaaaggagcgtatcattcagctatta
gaaaaagctgaagcaagcgctgcaccgaaaaggggaggaaataaaacatga

DBGET integrated database retrieval system