KEGG   Bacillus subtilis subsp. subtilis 168: BSU12550
Entry
BSU12550          CDS       T00010                                 

Gene name
xtrA
Definition
(RefSeq) phage-like element PBSX protein XtrA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PBSX_XtrA Ribosomal_L6
Other DBs
NCBI-GeneID: 939839
NCBI-ProteinID: NP_389137
Pasteur: BG11559
BSORF: BG11559
UniProt: P54344 A0A6M4JH67
Position
1324149..1324355
AA seq 68 aa
MIHPKKLLHIDSVTLKSQLEDGKIRVIIVDGIKQEAWITEAPEHGKTLVETRKGDLARVE
FEIGYKLN
NT seq 207 nt   +upstreamnt  +downstreamnt
atgattcatccgaaaaaactgctgcatatcgattccgtcacgcttaagagccagctggag
gacgggaaaatccgtgtcattattgtggacggcatcaagcaagaagcatggatcacagaa
gcgccagagcatggaaaaacgctcgtcgaaacaagaaagggcgatcttgctcgtgtggaa
tttgaaatcggctacaaattaaattaa

DBGET integrated database retrieval system