KEGG   Bacillus subtilis subsp. subtilis 168: BSU12560
Entry
BSU12560          CDS       T00010                                 

Gene name
xpf
Definition
(RefSeq) positive control factor
  KO
K24072  positive control factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU12560 (xpf)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU12560 (xpf)
SSDB
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 UPF0122 HTH_36 HTH_23 GerE HTH_38 HTH_29 HTH_10 Fe_dep_repress HTH_11 zf-HC2
Other DBs
NCBI-GeneID: 936474
NCBI-ProteinID: NP_389138
Pasteur: BG10998
BSORF: BG10998
UniProt: P39784 A0A6M4JIZ9
Position
1324471..1324980
AA seq 169 aa
MQDLLFEYKRTLKQTRIQYKPLAEADESVLSAEELKDKKIIRNMITDLEYVTEWLEKGRQ
PGIRRAIDRRDVYQRLMIKDPRIIESFSSAMMFEPDGQVSEEDRDRIREALALLTDREKE
MFLLHKVECFSYERIADLLGVKKSTVQTTIKRASLKMQRQQEEMNRSLA
NT seq 510 nt   +upstreamnt  +downstreamnt
atgcaagacttactatttgaatataaacgcacgctcaaacaaacaagaatacaatataaa
ccgctcgctgaggcagatgaatccgtgctctcagctgaagagctgaaggataaaaaaatc
atcagaaatatgattactgatcttgaatatgtaacagaatggcttgaaaaaggaaggcag
cccggcatcagacgggcgattgaccggcgtgatgtttaccagcggctgatgatcaaggac
ccgagaatcatcgaatcattttccagcgctatgatgtttgagccggacggacaggtatca
gaagaagacagagatagaattcgagaagcattagccctgttaacggacagagaaaaggaa
atgtttttgctgcataaggtagaatgtttttcttatgaacggatcgccgatcttctcggc
gtaaaaaaatcgacagtgcaaacgacgattaaacgggcgagtttaaagatgcaaagacag
caggaagaaatgaatcgatcacttgcctga

DBGET integrated database retrieval system