KEGG   Bacillus subtilis subsp. subtilis 168: BSU12570
Entry
BSU12570          CDS       T00010                                 

Gene name
xtmA
Definition
(RefSeq) PBSX phage terminase small subunit
  KO
K07474  phage terminase small subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU12570 (xtmA)
SSDB
Motif
Pfam: Terminase_2 Phage_terminase Terminase_5 HTH_23 HTH_24 HTH_AsnC-type HTH_38 DUF1804
Other DBs
NCBI-GeneID: 939835
NCBI-ProteinID: NP_389139
Pasteur: BG10999
BSORF: BG10999
UniProt: P39785 A0A6M4JFK4
Position
1325096..1325893
AA seq 265 aa
MKTQQREQALAIYQQHQGKITNRAIADTIGVSAKTIGIWKKQDKWKEALFSASKNEQKQR
PINNDELNERQRLFCLYYVKSFNATQSAIKAGYSPDSAHVTGSRLLKNEKVAAEIRRIKK
EMVNEMFIEAMDVLQVYIKIAFADITDYVTFGKKEVQAVGKSGPLFDEDDNPIMKEISFV
DVKDSGLVDGTIVTEAKLGKEGIAIKLADKMKALEKLSLYFDLFPDQFKQKIENEKLKLA
KQKAEKTDDSQEPIEIMIKRKERKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaaaacacaacagcgcgaacaagcattagcaatctatcaacaacatcaaggaaagatc
acaaatcgggcgattgcggacacaatcggtgtttccgcgaaaacaatcggcatctggaaa
aaacaagacaaatggaaagaggcgctgttttctgcgtccaaaaacgaacaaaaacagcgc
cctataaacaacgatgaattaaatgaacgccagcggctgttttgcctgtattacgtcaaa
agcttcaatgccacacagtcagcaatcaaagcgggctattctccggacagcgctcatgtg
acgggcagccgactcttaaaaaacgaaaaggtcgctgctgaaattagacgcattaaaaaa
gaaatggtcaatgaaatgtttattgaagcgatggatgtgctgcaggtttatatcaagatc
gcgtttgcggatattacggactatgtgacctttggaaaaaaagaggtccaggctgtcggg
aaatcgggtccgctgtttgatgaagatgataatccgattatgaaggaaatcagctttgtc
gatgtcaaagactccgggctcgttgatggcaccattgtaacggaagcaaagcttgggaaa
gaaggcattgccatcaagcttgcagataaaatgaaggcgcttgagaagctatccttatat
tttgatttgtttccagatcaatttaaacaaaaaattgaaaatgagaaattgaagcttgcc
aaacaaaaagcggagaaaacagatgacagccaggagccgattgaaattatgatcaaacga
aaagagcgcaagtcatga

DBGET integrated database retrieval system