KEGG   Bacillus subtilis subsp. subtilis 168: BSU12580
Entry
BSU12580          CDS       T00010                                 

Gene name
xtmB
Definition
(RefSeq) PBSX phage terminase large subunit
  KO
K06909  phage terminase large subunit
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    BSU12580 (xtmB)
SSDB
Motif
Pfam: Terminase_3 Terminase_3C Terminase_6N
Other DBs
NCBI-GeneID: 939426
NCBI-ProteinID: NP_389140
Pasteur: BG11000
BSORF: BG11000
UniProt: P39786 A0A6M4JM79
Position
1325890..1327191
AA seq 433 aa
MIVKEINPHFEDYVFNWEQTYQFLVGGYGSSKSYHTALKIVLKLLKEKRTALVIREVFDT
HRDSTFALFQEVIEELGLTKAVASLSSPLQLRFHNGSRIMFKGMDNPAKLKSVHNISLIW
IEECSEVKYEGFKELIGRLRHPELKLHMICTTNPVGTSNWTYRHFFRDERKKRFVLDDSE
LYEKRTIVKGDTYYHHSTANDNLFLPESYVKQLDGLKEYDPDLYRIARKGRFGVNGIRVL
PQFEVLPHDQVKKCIAAISKPIFRTGMDFGFEESYNAVVRLAVDPEKKYLYIYWEYYQNK
MTDDRTAEELREFIETQELIKADSAEPKSIQYFRQQGFRMVGARKFPGSRLQYTKKVKRF
KKIFCSDRCENVIYELETLTYAKDKNGALIEDEFTIDPHTLSAIWYALDDYEVADMKETA
HKRMRPNRERRRS
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgattgtaaaagaaatcaaccctcatttcgaagattacgtgttcaattgggagcagacg
taccagtttcttgtcggcggctacggctcatccaaaagctatcataccgcattgaaaatc
gtgctaaagctgctgaaggaaaaacggacggcccttgtgatccgggaggtgttcgatacc
catcgggattcgaccttcgccttgtttcaagaggtgatcgaagagctcggtctcacaaag
gccgtggcatctctttcttccccgctgcagctgcgatttcacaatggcagccggatcatg
ttcaaaggaatggacaatccggcaaaattaaaatcggttcataacatttcattaatatgg
attgaagagtgctcagaggtgaagtatgaggggttcaaggagttaatcggacgtcttcgc
catcctgagctaaagcttcatatgatctgtaccaccaatcccgtcggcacctccaattgg
acgtataggcatttttttcgggatgaacgcaagaaacggtttgtgctggatgacagcgaa
ctttacgaaaagcggacgattgtaaagggagatacgtattaccatcattccaccgctaac
gacaatctttttctcccggaaagctatgtgaaacagcttgacggactcaaagagtatgat
cccgacctgtaccggattgcccgaaaaggacgattcggcgtcaacgggatcagggtgctg
ccgcagttcgaggtactcccgcatgatcaagtgaaaaaatgtatcgcagccatcagcaaa
ccaatctttcgtacaggtatggattttggattcgaggaatcctataatgccgtcgtccgg
cttgctgtagatcctgaaaaaaaatacctctacatttattgggagtattatcaaaataaa
atgacagatgataggacggctgaggagctgcgtgagtttattgagacacaggaattgatc
aaagccgactcggctgagccgaaaagcattcaatatttccgccagcagggctttcggatg
gttggagccagaaagtttcccggctccaggcttcaatataccaaaaaggtaaaacggttc
aaaaaaatcttctgttcggaccgctgtgaaaatgtcatctatgagctcgagacacttacg
tatgccaaagataaaaacggagctctgattgaggatgaattcacgattgacccgcatacg
ctttctgccatttggtatgcgcttgatgattatgaggttgctgatatgaaagagacagca
cacaaacgaatgcggccgaaccgagaaaggaggaggtcataa

DBGET integrated database retrieval system