KEGG   Bacillus subtilis subsp. subtilis 168: BSU12590
Entry
BSU12590          CDS       T00010                                 

Symbol
xkdE
Name
(RefSeq) phage-like element PBSX protein XkdE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_portal
Other DBs
NCBI-GeneID: 936471
NCBI-ProteinID: NP_389141
Pasteur: BG11540
BSORF: BG11540
UniProt: P54325 A0A6M3Z9S2
Position
1327195..1328682
AA seq 495 aa
MHNQTVRATVFKANAAAPQTKQIYEDDFSELYGEDIIAPPYNIIELKTIAEYSTILQQCI
DAYRVNITGFGFDVEYTFDVNASDVDQAKKKRAEKDWARLEAFYKCLHFDESAEMILGYA
IEDREKTGNGFMEVLRDGAGKPAGIEYLDVKYMRVCGAGEPVEVSFVYEENGKMKRIKRQ
KRFRKYVQMINGKKVFFKEYGDPRKMDIRTGEYVNTLAEKYQANEAIHLKIGSGVYGVPR
WIGNIVNLYGARKAEELNFMYFKQGRHVPAAITVENGMLSEASYRELQEYMNDLEGVENA
HKFLLIEAEGIAKEKDLHGGEDITPVSVEIKSLAEILQNDALFLEYDEKSRNKLRSAFRL
PPLYTGEAQEYNRATADTARKITEEQVFQPERKTLVNKLNTLLLPELNIHDVRLTLKGPD
FRDPLEIAKVLGPFITAGAVSPNDLRDLAGRVLGKTLEEWPEDIYKRPAGQDAEKTNLAA
LMQELKESIEDIKTS
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgcacaaccaaacagtcagagcaactgtatttaaagccaatgccgcggctcctcagaca
aagcaaatctatgaagatgacttttctgagctgtacggagaggacattattgctccgccc
tataatatcatcgagctcaaaaccattgccgaatactcgaccattcttcagcaatgcatt
gatgcgtacagagtgaatattacaggctttggattcgatgttgagtacacatttgatgtc
aacgcaagtgatgtcgatcaggcaaaaaagaaaagagcggaaaaagactgggccagactc
gaagccttttataaatgtcttcactttgatgaatcagctgaaatgattttaggctatgcc
atcgaagacagagaaaaaacaggcaacggatttatggaagtgcttcgcgacggggcggga
aaacctgccggcatcgaatatttagatgtgaaatatatgcgtgtatgcggagcaggcgag
cctgtagaggtttcatttgtatatgaagaaaacgggaaaatgaaaaggatcaaaaggcaa
aaacgcttccgaaaatatgtgcagatgatcaatggaaagaaagtattttttaaagaatac
ggcgatccgcgaaaaatggatattcgcacaggtgaatatgtaaacacattggcagagaag
tatcaagcaaatgaagccattcacctcaaaatcggaagcggcgtatacggtgtaccccgc
tggatcggcaatattgtcaatttatacggggcccgaaaagcagaagagctcaattttatg
tattttaagcaggggcgtcacgtccccgctgcgattacagtggaaaacgggatgctgtct
gaagcttcttaccgggagctgcaggaatacatgaatgatcttgaaggcgtggagaacgcc
cataaatttctcctgatcgaagcggaaggaatcgcaaaagaaaaggatctccacggaggc
gaggatattacgccggtttccgtggaaatcaaatctttggctgaaattctccaaaacgac
gccttgtttcttgaatacgatgaaaaaagcagaaataagctgcgttccgcgttccgtctc
cccccgctgtatacaggcgaggcccaggaatacaaccgggcgacagcggatactgctaga
aaaattacggaggagcaggtttttcagccggagcgaaaaactctcgtgaataaactgaac
acgctgcttttgccggagctgaatatccatgacgtcaggctgacattaaaaggaccggac
tttcgtgatccgcttgagattgcgaaggtgctcggtccttttattacagccggagcagtc
tcgccgaatgatttacgcgaccttgccggacgggtgcttggcaaaacacttgaggagtgg
ccggaggacatttataaacggcctgcaggacaggatgcggaaaagacaaacctggctgcg
ctcatgcaggagctgaaagaaagcatcgaagatatcaaaacgtcctga

DBGET integrated database retrieval system