KEGG   Bacillus subtilis subsp. subtilis 168: BSU12600
Entry
BSU12600          CDS       T00010                                 

Gene name
xkdF
Definition
(RefSeq) phage-like element PBSX protein XkdF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_S78_2 Lipoprotein_2 FhuF
Other DBs
NCBI-GeneID: 939833
NCBI-ProteinID: NP_389142
Pasteur: BG11541
BSORF: BG11541
UniProt: P54326 A0A6M3Z9Q8
Position
1328702..1329529
AA seq 275 aa
MARELRNAKISFVSYVDKAANQTEFFFTKSAEPPSFEKKVRLFTKSEQDEQKLVYGIVYE
PDVPDAHGDFMTAEEIEKAAHGFLAEAREIDINHSFEGGTGVVVESYVAPDDFMIGSKRI
TKGSWVLVTRASDEVWEQIKAGIITGYSMAGTADVYEEEPVEKAGFFSVFKQMLADKTGK
ETEEMRKEDMKESFEHALYPLLKRLERIEKNTDTEEKPEQTGDDERLKKLVEDMLAPLIE
RIEALEKARGASKQTADDTGGNTEQVKKSIWSGLL
NT seq 828 nt   +upstreamnt  +downstreamnt
gtggcgcgagaattaagaaatgccaaaatcagctttgtcagttatgtggacaaggcggct
aaccagacagaatttttctttacgaagtcagccgaacctccgtcatttgaaaaaaaggtt
cggctgtttacaaaaagtgagcaggatgaacaaaagctcgtgtacggaatcgtgtatgag
cctgatgttcctgatgcccacggcgattttatgaccgccgaggaaattgaaaaagcggcg
cacggttttctcgcggaggcacgggagattgatatcaatcacagctttgagggcggaacc
ggcgtcgtggtcgagtcctatgtggcgcccgatgattttatgatcggatcaaagcggatt
acaaagggctcatgggtactcgtgacaagagcgtctgacgaggtgtgggaacagattaag
gctggaattatcaccggctacagcatggctggcactgcagatgtgtatgaagaagaaccg
gtcgaaaaagcagggttctttagtgtattcaagcaaatgcttgctgacaaaacagggaag
gagactgaagaaatgagaaaagaagacatgaaagaatcattcgagcatgcgctttaccct
ctgctcaaacggcttgagcggattgaaaaaaacacagacacggaggaaaagccggagcag
acgggtgatgacgagcgtctgaaaaagctcgttgaagacatgcttgccccgctgatcgaa
cgcatcgaggctttggaaaaagcgcgaggcgcgtctaagcagacagcggacgatacgggc
ggcaatacagagcaagtcaaaaaatcaatctggagcggactgctgtaa

DBGET integrated database retrieval system