KEGG   Bacillus subtilis subsp. subtilis 168: BSU12619
Entry
BSU12619          CDS       T00010                                 

Gene name
ykzL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3199
Other DBs
NCBI-GeneID: 8302945
NCBI-ProteinID: YP_003097713
UniProt: C0H3Z6 A0A6M3ZDA3
Position
1330512..1330895
AA seq 127 aa
MLIEPTDVASYSVYDRVKNRPEELLAQDIIEAEAEAALITGHRFEDSLYDPLPGKVKLAL
VKLAQYFALVNSDESASSSYQYEKMGDYSYTVSGEGRIQRPEVYHLLEEFIKPGYVPESS
RLKVRSL
NT seq 384 nt   +upstreamnt  +downstreamnt
atgctcattgaaccgactgacgtagcttcctattcggtctatgatcgggtgaaaaacagg
ccggaagagctgctggcgcaggatatcatcgaggcggaagcagaagcggctctcatcacg
ggccaccgctttgaagacagcttgtatgatccgctgcccggcaaggtgaagttggcttta
gtaaagcttgcccagtattttgcgcttgtcaacagcgatgaatctgcctcatcaagctat
cagtatgagaaaatgggggattattcctacacggtttccggagaaggcaggattcagcgg
cctgaggtgtatcatttgctcgaagagtttattaagccgggctacgtccctgaatcctcc
agactgaaggtgagatctttatga

DBGET integrated database retrieval system