KEGG   Bacillus subtilis subsp. subtilis 168: BSU12630
Entry
BSU12630          CDS       T00010                                 

Gene name
xkdI
Definition
(RefSeq) phage-like element PBSX protein XkdI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HK97-gp10_like
Other DBs
NCBI-GeneID: 939425
NCBI-ProteinID: NP_389145
Pasteur: BG11544
BSORF: BG11544
UniProt: P54329 A0A6M4JHN2
Position
1331245..1331730
AA seq 161 aa
MKIAGLKQLNTALKEAASGGFSRQASRWLEECGQDFLEIVQSELISTQTIDTEKLLSSFE
KGAEDNLWIVQSGGLSLEVGTQLDYASFLNDGHWTSKQDVRWVPGRFQGSRFIYDPAAST
GMALKRKWIPGTGYWDHALLLYEQLFEKSLESKLRQWLKKL
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaaaatagcgggattgaaacagctgaacacggcattaaaagaagcggcttcaggcggt
ttttccagacaggcgtcccggtggcttgaggagtgcgggcaagattttctagagatcgtc
caatctgaactcatcagcacacaaacgattgatacagaaaaactgctcagttcctttgag
aaaggcgcagaggacaatctctggattgtgcaaagcggcgggctttcgcttgaggtgggg
acacagcttgattacgcctcatttcttaatgacggccattggacgtcaaaacaagatgtg
agatgggtgccggggcgttttcaaggctcacggtttatttatgatccagcggcttcaacg
ggaatggcgctcaagagaaaatggataccgggcacgggctactgggatcatgcactgctt
ttatatgaacagctgtttgaaaaatcgctggaaagcaaactgcgccagtggctgaagaag
ctgtaa

DBGET integrated database retrieval system