KEGG   Bacillus subtilis subsp. subtilis 168: BSU12649
Entry
BSU12649          CDS       T00010                                 

Gene name
ykzM
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Ribosomal_L12_N
Other DBs
NCBI-GeneID: 8303162
NCBI-ProteinID: YP_003097714
UniProt: C0H3Z7 A0A6M3ZA49
Position
1332187..1332405
AA seq 72 aa
MSKDKQQKKAVHTKSREALFDTADLIKHAKELFGVKPDILQGALFGVDQPRMTKSEANQL
IQTFLTKEVMSS
NT seq 219 nt   +upstreamnt  +downstreamnt
gtgtcaaaggacaaacaacagaagaaggctgtacatacaaagagccgggaagctctattt
gatacagcggatttgattaagcacgcgaaggaactgttcggcgttaagccggatattctt
cagggggctttatttggcgtggatcaaccacgtatgacgaaatcagaagccaaccaattg
attcaaacatttctaaccaaggaggtcatgtcatcatga

DBGET integrated database retrieval system