KEGG   Bacillus subtilis subsp. subtilis 168: BSU12650
Entry
BSU12650          CDS       T00010                                 

Gene name
xkdK
Definition
(RefSeq) phage-like element PBSX protein XkdK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_sheath_1 Phage_sheath_1C Phage_sheath_1N Rota_VP4_MID
Other DBs
NCBI-GeneID: 939943
NCBI-ProteinID: NP_389147
Pasteur: BG11546
BSORF: BG11546
UniProt: P54331 A0A6M4JFL3
Position
1332402..1333802
AA seq 466 aa
MNGGTFTTGKEKERAGIYFNFKTTAQERVSLSERGTVALPVASSWGEAKTFVSISSVEDL
NKKVGLSIDDPSLLLLREAKKNAKTVLMYRLTEGVRASADIAEGVKATAVYGGTKGNDII
IRINQNVLDANSFDVTTYMDESEVDKQTVKKAEELTANGYVTFTGTGDLSSTIPLTGSEG
DTAAETLNASAGIRLSGGTDKAPVNSDYTDFLAAAETESFDVIALPVAEGDQLKATFAAF
IKRLRDGQGQKVQGVTANYAGDYEGIINVTEGVLLEDGTEVTPDKATAWVAGASAGATFN
QSLTFVEYEGAVDVLHRLDHDTIVERLGKGEFLFTFDARDKSVSVEKDINSLVTFTAEKN
KKFAKNKIVRVLDAVNNDLTRELKALIKSRKGSGSDIPASEDGLQYVKTMITQYMTTLQD
AGGITGFDSDEDITISMNEDRDGFLIDLAVQPVDAAEKFYFNVEVN
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaatggcggaacatttacaacaggcaaagaaaaagaacgtgcaggcatttattttaac
tttaaaacgacggcacaggagcgggtatcactcagtgaacggggaacagtcgcacttccg
gtcgcctcaagctggggcgaagcgaaaacgttcgtctccatttccagcgttgaagaccta
aacaaaaaagtgggcctcagcattgatgacccgtctttattgctgctgcgtgaagcgaag
aaaaatgcgaaaacggtattgatgtaccgtctaaccgaaggtgtccgagcgtctgctgat
attgctgaaggcgtcaaagcaactgcagtatatggcggaacaaaaggaaatgacattatc
atccgcatcaatcaaaatgtgctggatgctaattctttcgatgtgacaacatatatggac
gaatcagaggttgataaacagactgtcaaaaaggctgaagaattaacagctaacggctat
gtcacttttaccggaacaggcgatctttcttcaacgattcctctcactggatcagaagga
gacactgcagctgagacgctgaatgcatccgcgggcatccgtttatccggcggtacggat
aaagcccctgtcaactccgactatacagatttcttagccgcggctgaaacggagagcttt
gatgtgattgcgctgcctgttgcagaaggtgaccagttgaaagcgacgtttgctgctttc
attaaacgcctgcgcgacggccaaggacaaaaagtgcaaggcgtcacagccaattatgcc
ggtgattatgaaggcatcatcaacgtaaccgagggtgtgctgcttgaagatggcacggaa
gttacaccggacaaagcaacagcttgggtagctggagcgagtgcaggagcaacctttaac
caatcacttacatttgtagagtacgaaggcgcagttgatgtgttacaccgccttgaccac
gatacgattgttgaacgtctgggtaaaggtgaatttttattcacattcgacgcccgtgat
aaatccgtcagcgtagaaaaggatattaactcactcgtgacgttcacagctgagaaaaac
aagaaatttgcgaagaacaaaatcgttcgtgtcctggatgctgtgaataatgatttaaca
cgcgagctgaaagccttaattaaatcaagaaaaggcagcggaagcgatatcccggcatct
gaagacggactgcagtatgtaaaaacgatgatcacacaatacatgacaacgcttcaggac
gcaggcggcatcactggctttgattccgatgaagatatcacaatttcaatgaatgaagat
cgtgacggcttcttgattgacctggctgtacagcctgtcgacgcagcagaaaaattctac
tttaatgtggaggtaaactaa

DBGET integrated database retrieval system