KEGG   Bacillus subtilis subsp. subtilis 168: BSU12660
Entry
BSU12660          CDS       T00010                                 

Symbol
xkdM
Name
(RefSeq) phage-like element PBSX protein XkdM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2001 IHO1 Laminin_G_3
Other DBs
NCBI-GeneID: 938181
NCBI-ProteinID: NP_389148
Pasteur: BG11547
BSORF: BG11547
UniProt: P54332 A0A6M3Z9N7
Structure
PDB: 
2GUJ

Position
1333804..1334247
AA seq 147 aa
MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGRRMTGHKTTGANGTGT
ATFYKVTSKFVLLMMDYVKKGSDPYFTLQAVLDDQSSGRGTERVTLYDVNFDSAKIASLD
VDSEALEEEVPFTFEDFDVPEKLSDTF
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcattaaaagcacaaaacacaatctcaggaaaagaaggccgtttattcctcgatggt
gaggaaatggcacacatcaaaacttttgaagcaaacgtcgagaaaaacaagtctgaagtc
aacattatgggccgccgcatgacaggccataaaacaacaggggcaaatggaacagggacc
gcgacgttctacaaagtcacatcaaaattcgtgctattgatgatggactatgtcaaaaaa
ggcagcgacccttatttcacgctccaagctgtgctggatgatcaatcctccggccggggc
acagagcgagtcacgctgtacgacgtcaactttgactctgccaaaatcgcaagccttgat
gtcgattcagaagcgttagaggaagaagttccatttacattcgaagacttcgacgtccct
gaaaagctatctgacacgttttaa

DBGET integrated database retrieval system