KEGG   Bacillus subtilis subsp. subtilis 168: BSU12671
Entry
BSU12671          CDS       T00010                                 

Gene name
xkdN
Definition
(RefSeq) phage-like element PBSX protein XkdN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_TAC_5
Other DBs
NCBI-GeneID: 939842
NCBI-ProteinID: NP_389149
UniProt: P54333 A0A6M4JKU8
Position
1334339..1334785
AA seq 148 aa
MSEKNENVYDLSFFMPGKTIEAEEIKVPISKRFVDKKGNVIPFILKPITTERIDELEKEN
TTFKNVKGRGRVKDLDSQRFYARIAIESTIYPDFRSKDLREAYKTADPVEVAKRVLSVGG
EYANWLNKAIEINGFEDDLEDLEEEAKN
NT seq 447 nt   +upstreamnt  +downstreamnt
atgagcgagaagaacgaaaacgtatatgatctttccttttttatgccgggaaaaacaatt
gaagctgaggaaatcaaagtgccgatctcaaagcgttttgttgataaaaaagggaatgtc
attccgtttattttaaaaccaattactactgaacggattgatgaattagagaaagaaaac
accacatttaaaaatgtgaaaggccgcggccgtgtcaaagatttagactcccagcgcttt
tatgcgagaattgccatcgaatctactatttatcctgattttcgttcaaaagatttaagg
gaagcatacaaaactgcggatccggtagaagttgccaaacgtgtattatctgttggggga
gagtatgcgaactggctgaataaagcaattgaaatcaatggttttgaagatgatcttgaa
gatctagaagaagaagcaaaaaactag

DBGET integrated database retrieval system