KEGG   Bacillus subtilis subsp. subtilis 168: BSU12672Help
Entry
BSU12672          CDS       T00010                                 

Gene name
xkzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303192
NCBI-ProteinID: YP_003097715
UniProt: C0H3Z8
Position
1334815..1334964
Genome map
AA seq 49 aa AA seqDB search
MYYAMHELHYSPSQLLELYEAPKHFKALLFGLIGYKLDLLEKESRRGGN
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
ttgtactatgcaatgcatgagcttcattactcgccatcccaacttcttgaattatatgaa
gcaccaaaacattttaaagctcttttatttgggttgataggttataagctagatctatta
gaaaaagaatcaaggagaggagggaactaa

DBGET integrated database retrieval system