KEGG   Bacillus subtilis subsp. subtilis 168: BSU12680
Entry
BSU12680          CDS       T00010                                 

Gene name
xkdO
Definition
(RefSeq) phage-like element PBSX protein XkdO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SLT Phasin
Other DBs
NCBI-GeneID: 936500
NCBI-ProteinID: NP_389150
Pasteur: BG11549
BSORF: BG11549
UniProt: P54334 A0A6M3ZM39
Position
1334966..1338964
AA seq 1332 aa
MAKLTARFDLEDKVSKKLKRIHKGFQEVEKKVKTINRQIKISIRAEDQAFYRLRKINDYI
ILKFAKSLEIKVVLDDQVTSKLDAIERKLKRLPKETKLTVSLVDRTAAAYKKIKKMLSNQ
KLSFLLIPDDKVTSTVKRIIGYIKKNLKNGYTVKLKVIDEITKTVNRLTALLRKFEKTYY
VKVVVKTKISDKINKKESLINKETSKKESDKSSDKGSDKNSDQKPGWVGKIKGWLKDWWT
KSAWPWIKDTLNEIGKAFLDRFKERLIEKLKNDVFDKIIDKILGPQKKDDSGENSDTDKK
VLNRNTGGNCCCDCCEGGISPGTKNKKTYRKKKSPTKAPNRTLKVPGEVIRRRQSGTPAE
SAPRTSGSKLKNWLGGLKSLGKDSSKLGKAFRGMGKAVPYVGSALAVFDLAGINKDNAGE
KVGSIGGRIAGAEAGATAGAEAGATIGSFVGPEGTAIGGAIGGIGGGLVGGIGGEEAGKN
IGKMFDTSKLKESISNSLFNKEWWSGKWNSISDTANGAITWIEDTWSKVSTWFDQYVFTP
IYNVAVPVINFIVGLFAYAWDGILAVWNIVYPWFKDNVWDPISGAVTNVATTIWTGLCNA
WTVISGIWSTVSTWFMDNVWNPVSEAVTTAATWIWSKINDAWTIISNIWTGVSNWFYDNV
WNPIVKKVEDIKTSIKEKFDDARKFFEDAWDGIETWFNEHVKDPLVKVSEKIAEKFQWLF
DLKDSVGGFVAKVIHRGEEVTHLKKKPIKKDSKEKKTSSKPTTNNIFAQSPSNNNMTVFQ
QALDQNATGGYITKPTISWIGEAGKEFVIPVDNNRGRGKMLLSQAASKLGMQVVDDMGAA
SSSGGSPASVSGGAAVSPLSGTASPVMNTANLTGQASTLGQQFSEGFGKGISDQPVKMED
WKKKNINTPFTQMISASPNYGKQMVSGYAKGQSGTATGTDGFLQSKVKTPFQATVSKSSS
WGTGTVKGFAQGQNSTQTGTAQYVSTHVDKPFLRSKDTSNSWGSGLIGNFVTGMNSKSSE
VKQAAKDMAKRVEQAFREELDIHSPSRVMMSLGRFASVGVVKGLDSVDVKKYAEKQAGSL
AAAYSGMGAVGGNVKQWLMAAIMATKTPLSWLSGLMTIAQYESGGNPNSINLWDSNAKAG
NPSQGLMQTVPTTFNAHKAPGMGNIRNPIHNAAAAIGYIKSRYGSIDNVPGIKSLKRGGP
YVGYANGGLITKEQIARVGEGNKREWIIPEERGIRGRYLLQRAAQALGMEVTDPSQSQQS
ELSSGQVSAVTSASRPTAAVSGSKEIYIQFNGDQHFHNGQDAESLAAKIKQALIDELQKD
INIGTKGVVAFD
NT seq 3999 nt   +upstreamnt  +downstreamnt
atcgcaaaattaacagcccgttttgatctcgaagacaaggtatctaaaaaactaaaacgg
atacataaaggattccaagaggtcgaaaaaaaagtcaaaaccattaatcggcaaatcaaa
atcagtatcagagcggaagatcaggcattttaccggctgagaaaaataaacgactatatc
attttgaaattcgcgaaatcgcttgaaattaaagttgtacttgatgaccaagtcacttca
aagcttgatgcaattgaaagaaaacttaaacggctgccgaaagaaacgaagctgactgtc
tctttggtagatcggacagcagctgcgtataaaaaaataaagaagatgctttctaatcaa
aagctatcattccttttgattccagatgacaaggttacttctacagttaaaaggattatc
ggttatattaagaaaaatttgaaaaacggatacacagtaaaactaaaggtcatcgatgaa
atcaccaaaacagttaatcgattaacagcccttctaaggaaatttgaaaaaacctattat
gtaaaagtggttgttaagacaaaaatatcagacaaaatcaataaaaaagaaagcctgatt
aacaaagaaacttctaagaaagaatcagacaaatcctcagataaaggctctgataaaaac
tcagatcaaaaacctggatgggtcggaaaaataaaaggctggctgaaggattggtggaca
aaatcagcttggccttggatcaaagatacgctcaatgaaataggcaaagcttttttggat
cgtttcaaagagagattgatagaaaagctgaaaaatgatgtgtttgataagatcattgat
aaaattctaggaccacaaaaaaaggacgattctggtgaaaattctgacacagataaaaaa
gtccttaaccgtaatacaggaggaaattgttgctgtgactgctgtgaaggcggtatcagc
ccgggcactaaaaataaaaaaacctatagaaaaaagaaaagtcccacaaaggctccaaac
agaacactcaaggttcctggagaggtgataagaagacgccagagcggcacacctgctgaa
agtgcacctaggacctcgggttccaagttaaagaactggcttggaggcttaaaatcgcta
gggaaggattcatctaaactaggtaaagcgttcagaggaatgggaaaggctgttccatac
gtaggatctgctttagcagtgtttgatttagctggaatcaataaagataatgctggcgaa
aaggttggttcaattggaggacgtattgccggagcggaagctggtgcaacagccggagcg
gaagctggtgcaacgattggatctttcgttggtccggaaggtacagcaatcggcggcgca
atcggcggaattggcggcgggttagtaggcggaatcggcggcgaagaagcaggtaagaac
attggtaagatgtttgatacttctaagttaaaggagagcataagcaattcactatttaac
aaagagtggtggagtggaaaatggaactccatttctgatactgccaatggggctattact
tggattgaagatacatggagtaaagtttcaacttggtttgaccagtatgtgtttacacct
atatataatgttgctgtacctgtaattaattttatagtaggattgtttgcctatgcctgg
gatggcatattggcagtatggaacattgtctacccgtggtttaaggataacgtgtgggat
ccaataagcggagcagttactaatgttgctacaacgatatggactggattgtgcaacgcc
tggacggttatttcaggcatatggtctactgtttcaacatggtttatggacaatgtgtgg
aatcctgtaagtgaagccgtaaccactgcggcaacatggatttggagtaagatcaatgat
gcatggacaataatttccaatatttggacaggagtatcgaattggttttatgataatgta
tggaacccgatcgtcaaaaaagtagaagatattaaaacttcaataaaagaaaaattcgat
gatgcaaggaaattttttgaggatgcatgggatggaattgaaacttggtttaatgaacat
gtgaaagatccattggttaaagtatcagagaaaattgctgagaaatttcaatggctattc
gatttaaaagattcagttggtggtttcgttgcaaaagtaatacacaggggggaagaagtt
actcacctcaagaaaaaaccaatcaaaaaggattcgaaagagaaaaaaactagttccaaa
ccaactactaataacatttttgctcaatctccatcaaataataatatgactgtttttcaa
caagcactagatcagaacgccacaggcggctacatcaccaaaccaaccatctcgtggatc
ggtgaagccggcaaggaattcgttatcccggttgataacaaccgaggccgggggaagatg
cttctttcacaagcggcgtctaagctgggtatgcaagttgtagacgacatgggcgcagct
tcgtcttctggcggaagtccagcatctgtttcaggaggagcagctgtcagtcctctatca
ggcacagcctccccagtaatgaacactgcaaatcttacaggccaagcgtccacactcgga
cagcaattttcagaaggctttggtaaaggcatcagcgatcagccggtcaaaatggaagac
tggaaaaagaaaaacatcaatacaccatttacacaaatgatttctgcttcaccaaattac
ggtaaacaaatggtaagtgggtatgccaagggccaaagcggcactgcaaccggaacagac
ggctttttgcaatcaaaagttaaaacgccgttccaagccactgtgagcaaatcgtcttca
tggggcacaggaacggtcaaaggctttgcgcaaggacaaaattcaacccaaacagggact
gcacagtatgtgagtacacatgttgacaaaccgttcctgcgttcaaaagacacatcgaac
agctggggctccggtttgattggaaactttgtgacaggcatgaattctaaatccagtgaa
gtaaaacaagcagcaaaggatatggccaagagagtggagcaggctttccgtgaagaatta
gatatccattcaccttctcgagtcatgatgagcttggggcgttttgcctctgtcggtgtt
gtaaaaggactggattctgtcgatgtgaaaaaatacgcagaaaaacaagccggttcattg
gcagctgcttattccggaatgggtgcagtagggggaaatgtgaaacagtggcttatggca
gcaataatggccacaaagacaccattgagctggctctcgggattaatgacgattgcacag
tatgaatcagggggcaacccgaactctattaacctgtgggatagcaacgcgaaggcggga
aatccatcacaaggactcatgcagacagttccaaccacatttaatgctcataaagcaccg
ggcatgggtaacattagaaatccgattcacaacgctgctgccgcgatcggctatatcaaa
agcagatacggctcaattgataatgtacctggcattaaaagcctgaaacgtggcggtcct
tatgtcggttatgcaaacggcgggctgatcacgaaagaacaaattgcccgtgtcggtgaa
ggaaacaagcgggaatggatcatcccagaggaacggggcatccgcggtcgctaccttctt
cagagagcggcacaggctcttggtatggaagtgacagatccgtctcaatcccagcagtct
gagctttcttcaggacaagtttcagctgttacctcggctagccggccgactgcagcggtt
tctggatcaaaagagatttatattcaatttaacggtgaccagcacttccataatggacaa
gacgccgaaagcctagcggcgaagatcaagcaggcgcttatagatgaactgcaaaaggat
atcaatattggaacgaagggagtcgttgcatttgactaa

DBGET integrated database retrieval system