KEGG   Bacillus subtilis subsp. subtilis 168: BSU12690
Entry
BSU12690          CDS       T00010                                 

Symbol
xkdP
Name
(RefSeq) phage-like element PBSX protein XkdP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: LysM Stm1_N
Other DBs
NCBI-GeneID: 939946
NCBI-ProteinID: NP_389151
Pasteur: BG11550
BSORF: BG11550
UniProt: P54335 A0A6M4JFD9
Position
1338957..1339616
AA seq 219 aa
MTKSVYEFWISQGKDKLRLPVLPDQLSISNTVQNETVKVAKFGDLTFIDEQGAKEISFSS
FFPKKYSPIAEYQNFPSPENAITKIEKWMKAKKPVQFLITGTKVNLTCSIEGFSYSEGQQ
DIGDRSFDIQLKEYKTASPRKIKQKKKTKAKRPSKAAPKTYTVKKGDTLWDIAGRFYGNS
TQWRKIWNANKTAMIKRSKRNIRQPGHWIFPGQKLKIPQ
NT seq 660 nt   +upstreamnt  +downstreamnt
ttgactaaatccgtatatgaattttggatttcacaagggaaggacaagctgcggctcccc
gttcttcccgaccagctgagtatttcaaatacagttcagaatgagacggttaaagtagcc
aagttcggtgaccttacatttattgacgagcagggagcgaaagaaatttcgttctcttct
ttttttccgaagaaatacagtccgatagcagaatatcaaaacttcccgtcgccggaaaat
gcgataacaaaaattgaaaaatggatgaaggccaaaaaaccggttcagtttttgattacg
ggaactaaagtgaatttaacatgcagtattgaaggtttttcctatagcgaaggccagcag
gatataggtgatcgttcctttgatattcaattaaaagaatacaaaaccgcttccccgcgg
aaaatcaagcagaagaaaaaaacaaaggcaaaacgtccgtcgaaggctgcgccgaagacg
tacacagtgaaaaagggagacacgctatgggacattgcaggcagattttacgggaacagc
acccaatggcgcaaaatttggaatgccaataaaacagcaatgatcaaacgaagcaaacgg
aacatcaggcagccgggccactggatttttcccggccaaaaattaaagataccgcaatga

DBGET integrated database retrieval system