KEGG   Bacillus subtilis subsp. subtilis 168: BSU12700
Entry
BSU12700          CDS       T00010                                 

Gene name
xkdQ
Definition
(RefSeq) phage-like element PBSX protein XkdQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1428 2CSK_N
Other DBs
NCBI-GeneID: 938173
NCBI-ProteinID: NP_389152
Pasteur: BG11551
BSORF: BG11551
UniProt: P54336 A0A6M3ZJD0
Position
1339632..1340609
AA seq 325 aa
MIELFVIKDTEWLELVAESVSLEGHRYQAPRSIEATIVTKQGDQTYYSVSEGDTVLFKWK
GKELFRGIVFARTPDEHTLAFSAYDMLQYLVKNQDMYVFSNQRADQIIRRIASDFQIPTT
SIANTGHTIKSLVIKNDTTLYDIILKALKQTKSQTGRHYQLYSEKGKLGLRAWPDPSEVW
VLETGVNITGYQYSTSINDTATRVVLRRQKDNKTYKASAKDSSGLNKYGVLQYTETVTDD
INQAQLQQRADVRLAEKKGVKKELKNIQAVGIPEVQSGLPVYISIPEAGIKKTYWVDTDR
HEFKGTKHTMTIDVVEKNTMPEGVS
NT seq 978 nt   +upstreamnt  +downstreamnt
atgatagaactgttcgtcattaaagacacagagtggcttgagctggttgcagaaagcgta
tcgcttgaaggccatcgttatcaggcgccgcgttccattgaagcaaccatcgtcaccaag
cagggcgaccagacgtattacagtgtctcagaaggagatacggtcttgtttaaatggaag
ggaaaagagctgtttcggggcattgtttttgcaagaaccccggacgagcatacgcttgcc
ttcagcgcttatgacatgctgcagtacctggtcaaaaaccaggatatgtacgtgttttcc
aatcagcgggccgaccagatcatcagaaggattgcgagtgacttccagataccgacaacc
tcgatcgcaaacacaggccatacgatcaaaagtcttgtcattaaaaatgatacgacattg
tatgacatcatattaaaagcgctgaaacagacgaaaagccagacaggacgacattaccag
ctgtattcggaaaaaggaaagctcggcctgcgcgcttggccagatccgtcagaggtatgg
gtgcttgaaacgggcgtcaatatcacgggctaccaatacagcacttctataaacgacact
gctactcgggtggtgcttcgccggcagaaggacaataagacatataaagcctctgccaag
gacagttcaggcttaaataaatacggtgtgcttcaatatacggaaacggtcacagatgac
atcaaccaggcacagcttcagcagcgggcagatgtacgccttgctgaaaaaaagggcgtg
aaaaaagaactgaaaaatattcaggcagtgggcatcccagaagtgcagagcggcttgcct
gtctatatttcgattccggaggccggcatcaagaaaacctattgggtagatacggaccgg
catgaatttaaaggaacgaaacatacgatgacgatcgatgttgtcgaaaagaatacgatg
ccggaaggagtttcctga

DBGET integrated database retrieval system