KEGG   Bacillus subtilis subsp. subtilis 168: BSU12710
Entry
BSU12710          CDS       T00010                                 

Gene name
xkdR
Definition
(RefSeq) phage-like element PBSX protein XkdR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2577
Other DBs
NCBI-GeneID: 939427
NCBI-ProteinID: NP_389153
Pasteur: BG11552
BSORF: BG11552
UniProt: P54337 A0A6M3ZDA8
Position
1340609..1340875
AA seq 88 aa
MRLSEAIKHLAVGAVDAESPVELLPAEVVSVSPVEIKLKENSKLIIPEDAIIIPKRMQSG
GDDALEPGDRLMTAALTGGQSFFILDKV
NT seq 267 nt   +upstreamnt  +downstreamnt
atgagattaagtgaggctataaaacatttggcagtcggcgcagttgacgctgagtctccg
gtagaactgctcccggctgaagtcgtttcggtttctcctgtggaaatcaaattaaaagaa
aacagcaaactgatcataccggaagacgccatcattatcccaaaacgaatgcagtccgga
ggagacgatgcactcgagccgggggatcgcctcatgaccgcggctctgactggcgggcaa
tcgttttttattttagataaggtatag

DBGET integrated database retrieval system