KEGG   Bacillus subtilis subsp. subtilis 168: BSU12720
Entry
BSU12720          CDS       T00010                                 

Gene name
xkdS
Definition
(RefSeq) phage-like element PBSX protein XkdS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2634
Other DBs
NCBI-GeneID: 939840
NCBI-ProteinID: NP_389154
Pasteur: BG11553
BSORF: BG11553
UniProt: P54338 A0A6M3ZA44
Position
1340932..1341357
AA seq 141 aa
MALTPEVEFEDIEVESEVIETSQTYKIDFENGRITNELITGLEAIRQFVYIALQTERYAY
SIYSHNVGNELQDVLTDHETTDAYKKMEIPRLIEEALVYDDRISAVTDFEIEKQGDAFHV
SFVVETDEGTLEIEEVIGEDV
NT seq 426 nt   +upstreamnt  +downstreamnt
atggccctgacaccagaagtggagtttgaagatattgaagttgagagcgaagtcattgaa
acctcgcaaacgtacaaaatagattttgaaaacggaagaattacgaatgagctgattacc
gggcttgaagcgatcaggcagttcgtgtatatcgccttacagacagaacgctatgcatat
tccatatacagccataatgtcggaaacgagcttcaggacgtgctgacagatcatgagacg
actgatgcgtataaaaagatggagattccgagactgatagaagaggcgctggtttatgat
gaccggatatctgctgtaacagattttgagattgaaaaacaaggcgacgcgtttcatgtg
tccttcgtggtggagacggatgaaggaacgcttgagattgaggaggtgattggcgaagat
gtttga

DBGET integrated database retrieval system