KEGG   Bacillus subtilis subsp. subtilis 168: BSU12730
Entry
BSU12730          CDS       T00010                                 

Gene name
xkdT
Definition
(RefSeq) phage-like element PBSX protein XkdT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Baseplate_J DUF6528
Other DBs
NCBI-GeneID: 936475
NCBI-ProteinID: NP_389155
Pasteur: BG11554
BSORF: BG11554
UniProt: P54339 A0A6M4JH84
Position
1341350..1342396
AA seq 348 aa
MFEDQTFEAIMERMLNSISADIDTREGSVIYNALAPAAAELAKSYIWLDTVLELVFSDTA
QGEFLDRRAAEAGIERTAATKAVRAGEFTSGVTIPVGSRFYVDNLYFQYTADGTLICETP
GEAGNANLTGRNLLSLDTIPGLETAIVKEILIPGREEEGDDSLRERYFTRVRREAVSANK
MHYKEWAEEVDGVGKAKIFPLWNGEGTVKIVVTNANLEPASPILIQKVKDYIDPEPGQGE
GQAPIGAVVTVESAVWKEVEISAEVLPEINHSIDEVKSEIEEGVLNFFKKMAFEDNVIRL
SQINNIVYNSPSVSDYSNIQINGTSENLVLSDVEIPKLGQVKIIEQTR
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtttgaagatcagacttttgaagcgattatggagcgtatgctgaacagcatttccgca
gatattgacacaagagaaggcagcgtcatttataatgcgttagccccggcggcggccgag
cttgcgaagtcttatatatggctggatactgtgcttgagctagttttttctgataccgca
caaggcgaatttttagacaggcgtgcagcggaagcgggaattgaacggacagccgcgaca
aaggcggtcagagcgggagagtttacatctggagttactattcctgtcggctcccgcttt
tacgtggataatctttattttcaatatacggcagacgggacgctcatctgtgaaacacct
ggtgaagcgggaaacgccaatctgaccggacgcaatttactgtcattggataccattccc
ggtttagaaacggccattgtcaaagaaatcctgattccggggcgcgaggaagagggagat
gacagcttgcgagaacggtattttacaagggttcggcgtgaggccgtcagtgccaataaa
atgcattataaagagtgggctgaggaagtggacggtgtgggaaaggcaaagatcttcccg
ctttggaacggtgaaggcacggtcaaaattgtcgtcaccaatgcgaatcttgagcccgct
tctcctattttaattcaaaaagtgaaagattatatcgaccctgaaccaggacagggagag
ggacaggcgccaatcggagccgttgtcacggtggaaagcgcggtctggaaggaagttgag
atttctgccgaagtgctgcctgagatcaatcactcaattgatgaagtgaagtcggaaatt
gaggaaggcgttttaaacttctttaaaaaaatggcgtttgaagacaacgttatccgcctt
tctcaaattaacaatatcgtctataattcaccatcagtcagtgactactccaatattcaa
atcaacggcacgtctgaaaatctggtgctgagcgacgtggaaattcctaagcttgggcag
gtgaagatcattgagcaaacaagatga

DBGET integrated database retrieval system