KEGG   Bacillus subtilis subsp. subtilis 168: BSU12740Help
Entry
BSU12740          CDS       T00010                                 

Gene name
xkdU
Definition
(RefSeq) phage-like element PBSX protein XkdU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2313 ACT_4
Motif
Other DBs
NCBI-GeneID: 936476
NCBI-ProteinID: NP_389156
Pasteur: BG11555
BSORF: BG11555
UniProt: P54340
Position
1342380..1342958
Genome map
AA seq 192 aa AA seqDB search
MSKQDDMRAYLPPFLTSLKEMAELLKAEAPEFDKQNDSIFDLTDQLFVPTATWGLSRWEK
ILNVPRESGDTDEIRRLRLISKMSNIPPITYRAIEQAVNRFLKNPSAQVRLLPGEYRFNV
DINVDDLQHMNELIEAIENMKPAHLAYTLRGGLNETLRIKDTVILNHRRYRTASELKVGY
SVTLNNNEVVLT
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaaacaagatgacatgcgagcttatctgccgccgtttctcaccagccttaaagaa
atggccgagctgctgaaagcggaagcgcctgagtttgataaacaaaatgacagcatattt
gatctgacggatcagttattcgtaccgacggcgacttgggggctcagccgctgggaaaaa
attttaaacgtcccgcgggaatcaggcgacactgatgagatcagacgattgcggctcatt
tccaaaatgtcgaacatcccgccaatcacatacagggccattgagcaggcggtaaaccgt
ttcttgaaaaacccgtctgcacaggtccgcctgcttcccggcgaataccgatttaacgtc
gatatcaatgttgatgacctccagcacatgaatgagctgatcgaagcgatagaaaacatg
aaacccgctcatttggcgtatacgctcagaggcggattgaatgagacgctgcgaatcaaa
gatacagtcatcctgaatcaccgcagataccgaacagccagtgagctcaaggtcggttat
tctgtcactcttaacaacaatgaggtggttttaacttga

DBGET integrated database retrieval system