KEGG   Bacillus subtilis subsp. subtilis 168: BSU12749
Entry
BSU12749          CDS       T00010                                 

Gene name
xkzA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5643
Other DBs
NCBI-GeneID: 8303196
NCBI-ProteinID: YP_003097716
UniProt: C0H3Z9 A0A6M4JFM3
Position
1342955..1343227
AA seq 90 aa
MISTIYRERTAADLKSRIDHVLLNGQKTEIVELAIDGATVTVLTKREEDIKHIETVQIFD
ELGNVITERKTDLDVSENRTLDFRFTFEVV
NT seq 273 nt   +upstreamnt  +downstreamnt
ttgatttcaaccatatacagagaacgcacagcggctgatctaaaaagcagaatcgatcac
gtgctgctcaacggccaaaaaacagaaatagtagagctcgccattgacggtgcgacagtc
accgttctgacaaaacgtgaggaagacatcaagcatattgaaacggtacaaatttttgac
gagctgggcaatgtgatcacagagagaaagactgacctggacgtcagcgaaaacagaaca
ctcgatttcagatttacttttgaggtggtgtaa

DBGET integrated database retrieval system