KEGG   Bacillus subtilis subsp. subtilis 168: BSU12750
Entry
BSU12750          CDS       T00010                                 

Gene name
xkdV
Definition
(RefSeq) phage-like element PBSX protein XkdV
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: C1q
Other DBs
NCBI-GeneID: 939421
NCBI-ProteinID: NP_389158
Pasteur: BG11556
BSORF: BG11556
UniProt: P54341 A0A6M3ZA04
Position
1343230..1345293
AA seq 687 aa
MAYEEKTDWLPDDPINEDDVNRWEKGIKDAHTDLAAHKNDMNNPHNTTKAQIGLGNVDNV
QQASKTEFNEHNHDSTRHITSVERDEWNAKETPAGAQYKADQAEANAKAYTDNFAARRDN
PNQVTKAQVGLGNVENVKQASLADFDAHLSNSKVHVSEGERNKWNAAQLIKLTGDDGKRI
QLQDGTDILTLSSGFYCAVGQSVVNNPVEGDAAWYNYDIVEGGSGRKTIVAYQSWGSMMW
IGMVHTDGEFRGWKQIATTDFIDRVQTELDLHENDKTNPHSVTKQQVGLGNVENVKQETP
DGAQKKADTALNQSKDYTNSTAFITRPLNSITDANDLNLPPGTYRLDTNYMNANPVLQNQ
FPLNDNRTGLLIIYPSANKWATRQDWFSISTKTLYTRVAVNGTDYSGWYILENSEGSQNK
ADKALADAKNYVETNYTNQKLTVLTGSNAIQDARISGNDYKYGITFMDIGANNTTGYPLT
YGFVKNEKHSNYRFTQYFYGNADTTSGSYDHVGTWIRHWWADSGWTAWQKISGFAHANIG
TTGRQALIKGENNKIKYNRIIKDSHKLFDTKNNRFVASHAGMHLVSASLYIENTERYSNF
ELYVYVNGTKYKLMNQFRMPTPSNNSDNEFNATVTGSVTVPLDAGDYVEIYVYVGYSGDV
TRYVTDSNGALNYFDVLELGGRNYPRV
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggcatacgaagaaaaaacagactggcttccggacgacccaatcaacgaagatgacgtc
aaccgctgggaaaaaggaataaaagacgcccacaccgacctggctgcccacaaaaacgac
atgaacaacccccacaacacaacaaaggcgcaaatcgggctggggaatgtggataatgtg
cagcaggcttcaaagacggaatttaatgaacataatcatgattcaacccggcatattaca
tcagtagaacgtgatgaatggaatgcgaaggaaacacctgccggagcccagtataaggca
gatcaagctgaagcaaacgccaaagcatatacagacaattttgctgcacgaagagataat
cctaaccaagtaacaaaagcacaggttggacttgggaatgtcgaaaatgtgaaacaagcc
tcactagcagattttgatgctcatttaagcaattctaaagttcatgtatctgaaggggaa
agaaacaaatggaatgctgcccaactaattaaacttactggagacgacggtaaaagaata
caactccaagacggtacagatattcttacattatcttctggattttattgtgcagttggt
cagtcagttgtaaacaacccggtggaaggcgatgcagcttggtataactacgatattgta
gaaggcggttcaggaaggaaaacaatagtagcttaccaaagttggggaagtatgatgtgg
attggaatggttcacactgatggagaatttagaggatggaaacaaattgcaacaacagat
tttatagatagagttcaaacagaattagatcttcatgaaaatgataaaactaatcctcat
tcagttactaaacaacaagtgggtctcggaaatgttgagaatgttaagcaggagacacct
gatggtgcgcaaaaaaaagctgatactgctttaaaccaatcaaaagattatactaacagc
acggcctttattactagaccattaaattcaataaccgatgcaaatgatttaaatcttccg
cctggcacttatcgtttagacactaattacatgaatgcaaatccagttttgcaaaatcaa
tttccattaaatgataacagaacaggtttattaattatctacccctctgcaaataaatgg
gctacacgtcaagattggtttagcatctctacgaaaacactttatacaagggtagcagtt
aatggtactgattattcagggtggtatatattagagaattcggaaggttcacaaaataaa
gcggataaagctttagctgatgctaaaaactatgttgaaacaaattatacaaatcaaaag
ttaactgttctaacaggatcaaatgcaatccaagatgcgagaataagcggaaatgattac
aaatacggaatcacttttatggacataggggccaataacactacaggatacccgctcact
tatggatttgtaaaaaatgaaaagcatagtaattatcgctttactcagtatttctatgga
aatgcagacacaactagtggaagttatgatcatgtagggacttggatccgccattggtgg
gcagattcaggctggactgcgtggcaaaagatatcagggtttgctcacgctaatattggg
actactgggcgtcaagcccttattaaaggagaaaataacaaaattaaatataaccgtatt
ataaaagatagccataaattgtttgatacaaaaaacaataggtttgtagccagtcatgca
ggaatgcatttagtcagtgctagtttatatatagaaaatactgagcgatactccaatttt
gaattatatgtttatgtaaacggcacaaagtataaattaatgaatcaatttagaatgcct
accccttccaataacagtgataatgagtttaatgcaactgttactggatctgttacagtt
ccgcttgatgcaggagattatgttgaaatttatgtttatgttggttattccggggatgta
acacgatatgttacagattcgaatggagctctcaattattttgatgttctggagcttggc
ggaagaaattacccgagagtttag

DBGET integrated database retrieval system