KEGG   Bacillus subtilis subsp. subtilis 168: BSU12760
Entry
BSU12760          CDS       T00010                                 

Gene name
xkdW
Definition
(RefSeq) phage-like element PBSX protein XkdW
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: XkdW
Other DBs
NCBI-GeneID: 936237
NCBI-ProteinID: NP_389159
Pasteur: BG11557
BSORF: BG11557
UniProt: P54342 A0A6M4JKV8
Structure
PDB: 
2HG7

Position
1345305..1345634
AA seq 109 aa
MILYDAIMYKYPNAVSRKDFELRNDGNGSYIEKWNLRAPLPTQAELETWWEELQKNPPYE
PPDQVELLAQELSQEKLARKQLEELNKTLGNELSDIKLSLLSLKGDYAE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatcttatatgatgccattatgtacaagtatccaaacgcagtatcgagaaaggatttt
gaattgcgtaatgacgggaacggttcatacattgagaaatggaatctccgggcgccgttg
ccgactcaggcagaactcgaaacctggtgggaagagctgcaaaaaaatccgccgtacgag
ccgcctgatcaggtggagcttctcgctcaagaattgtcacaggaaaagctggcacgcaag
cagcttgaagagctgaacaaaacattagggaacgagttgtcagatataaagctatcatta
ctttccttgaaaggagattatgctgaatga

DBGET integrated database retrieval system