KEGG   Bacillus subtilis subsp. subtilis 168: BSU12770
Entry
BSU12770          CDS       T00010                                 

Gene name
xkdX
Definition
(RefSeq) phage-like element PBSX protein XkdX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_XkdX
Other DBs
NCBI-GeneID: 939941
NCBI-ProteinID: NP_389160
Pasteur: BG11558
BSORF: BG11558
UniProt: P54343 A0A6M3Z9T7
Position
1345631..1345795
AA seq 54 aa
MNYWVLALYYEWATTDMVKQALAYEDCSIQDLAEGVNKKLITADQYKEITGKAM
NT seq 165 nt   +upstreamnt  +downstreamnt
atgaattattgggtgcttgccctctattatgagtgggcgacaacggatatggtgaaacag
gctttagcatatgaagactgttcaattcaggatctggcagagggtgtgaacaaaaagctg
atcacagctgaccagtataaagaaattaccggtaaagccatgtaa

DBGET integrated database retrieval system