KEGG   Bacillus subtilis subsp. subtilis 168: BSU12820
Entry
BSU12820          CDS       T00010                                 

Gene name
spoIISB
Definition
(RefSeq) stage II sporulation protein SB
  KO
K06389  stage II sporulation protein SB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU12820 (spoIISB)
SSDB
Motif
Pfam: SpoIISB_antitox Chromo_2
Other DBs
NCBI-GeneID: 938005
NCBI-ProteinID: NP_389165
Pasteur: BG12678
BSORF: BG12678
UniProt: O34800 A0A6M4JJ28
Structure
PDB: 
3O6Q

Position
complement(1348442..1348612)
AA seq 56 aa
MERAFQNRCEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEYKRKKA
NT seq 171 nt   +upstreamnt  +downstreamnt
atggaacgtgcgtttcaaaacagatgcgagcccagagcggcgaagccgtttaaaatcctg
aaaaaacgttcaaccaccagtgtcgcaagctatcaagtcagtccgcatacagcaagaatc
ttcaaagaaaacgaacggctgattgacgagtataaacgaaaaaaagcatga

DBGET integrated database retrieval system