KEGG   Bacillus subtilis subsp. subtilis 168: BSU12840Help
Entry
BSU12840          CDS       T00010                                 

Gene name
pit
Definition
(RefSeq) low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU12840 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 936281
NCBI-ProteinID: NP_389167
Pasteur: BG13226
BSORF: BG13226
UniProt: O34436
Position
complement(1349468..1350469)
Genome map
AA seq 333 aa AA seqDB search
MDILLILTILIVICALAFDFINGFHDTANAIATSVSTKALKPRHAIILAAVMNFVGAMTF
TGVAKTITKDIVDPYTLENGSVVILAALLAAIAWNLITWYYGIPSSSSHAIIGAIAGAAI
AAAGFAALNYKGFIKIIEALILSPIIAFVLGFILYSIVKLIFKDSNLAKTNKQFRRVQIV
TAALQSYTHGTNDAQKAMGIITMALITANLHTSANDIPTWVQFACATAMGLGTSIGGWKI
IKTVGGKIMKIRPVNGVSADLTGAAIIFGATFIHLPVSTTHVISSSILGVGASHRVKGVN
WGTAKRMLITWVITLPISATLGAIAYFILNMIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggatattctattaatattaacgatactaatagtcatttgtgctctggcgtttgatttc
atcaacgggtttcatgatacggcaaacgcaattgcgacttcggtatcaacaaaagcgtta
aaaccgcgccatgccattatattggctgctgtgatgaactttgtcggagcaatgacgttt
acaggtgttgccaaaaccattacgaaagacatcgtagatccttatacgctggaaaatggc
tctgttgtcattttggctgcgctactcgctgcaattgcctggaaccttatcacatggtac
tacggtatcccaagcagctcatcccatgccatcatcggcgctattgccggtgcagccatt
gcggcagccggatttgcagcgttaaactataagggcttcattaaaatcattgaagcactg
attctatcaccaattattgcctttgtccttggttttattctttatagcatcgttaagctg
attttcaaagacagcaacttggcgaaaacgaataagcaattccgcagagtgcagattgta
acagctgccctgcaatcgtatacacacggaacaaacgatgcgcaaaaagcaatgggaatt
atcacaatggctctcatcacagcgaatttacatacttctgctaatgatattcctacctgg
gtgcaattcgcctgcgcgacagccatgggtctcggaacatcaatcggcggctggaaaatc
atcaaaaccgttggcggaaagatcatgaaaatccgtccggtaaacggtgtttccgctgac
ttaaccggagcagccattattttcggcgccacgtttattcatttgccggtcagtacaacc
cacgtcatttcttcatcaattcttggcgtcggtgcgtcccaccgcgtaaaaggcgtaaac
tggggtacggccaagcgaatgctcattacatgggtcatcacgcttccgatttcagcgaca
cttggtgccatcgcctactttattttaaatatgatattttaa

DBGET integrated database retrieval system