KEGG   Bacillus subtilis subsp. subtilis 168: BSU12850
Entry
BSU12850          CDS       T00010                                 

Gene name
ykaA
Definition
(RefSeq) hypothetical protein
  KO
K07220  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU12850 (ykaA)
SSDB
Motif
Pfam: PhoU_div PhoU PP-binding_2 Tsc35 DUF5021
Other DBs
NCBI-GeneID: 939843
NCBI-ProteinID: NP_389168
Pasteur: BG13225
BSORF: BG13225
UniProt: O34454 A0A6M3Z9Q4
Position
complement(1350482..1351099)
AA seq 205 aa
MIRRKKDKFSLLLTEIAKNIDETAEYFVNFKVTNQTTLKEFADTLKEYETKGDNHVHVMI
KELNKAFITPIEREDILQLTNSLDDVLDGIEHFSAMMEIFSITSSDEHIDKFSGYIRECA
KEILITIELLAENRLKDIQPHAIKIKEYEHSCDNLHRKSLKNLFGNETDPIKVIQYREIY
ETLEEIADSCQSVANNLETIIMKNA
NT seq 618 nt   +upstreamnt  +downstreamnt
atgataagaagaaaaaaagataagttctcactccttttaacagaaattgcaaagaacata
gacgaaactgcagaatattttgtgaattttaaggtcactaaccaaacgactcttaaagaa
tttgcagatacgttaaaggaatatgaaacaaaaggtgacaatcatgttcatgtcatgatt
aaagagcttaacaaagcgttcatcactcctattgagcgcgaagatatccttcagctgaca
aacagcttggatgatgtgcttgacggaatcgaacatttctctgccatgatggagattttc
tcaattacttcatcagacgagcatattgataaattcagcggatatatcagagaatgtgcg
aaagagattttgattacgatcgagctgctggcagaaaatcgcttaaaggatattcagcct
cacgcaatcaaaattaaagagtatgagcacagttgtgacaacttgcacagaaaatcatta
aagaatcttttcggaaatgaaacagatccaatcaaagtcattcaatatcgtgaaatatac
gaaacgcttgaagaaatcgccgactcttgtcaaagtgttgccaataatcttgaaaccatc
attatgaaaaacgcgtaa

DBGET integrated database retrieval system