KEGG   Bacillus subtilis subsp. subtilis 168: BSU12860
Entry
BSU12860          CDS       T00010                                 

Symbol
ykbA
Name
(RefSeq) serine/threonine exchanger SteT
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU12860 (ykbA)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 936518
NCBI-ProteinID: NP_389169
Pasteur: BG13227
BSORF: BG13227
UniProt: O34739 A0A6M3Z9U7
Position
complement(1351375..1352691)
AA seq 438 aa
MHTEDNGLKKEIGLLFALTLVIGTIIGSGVFMKPGAVLAYSGDSKMALFAWLLGGILTLA
GGLTIAEIGTQIPKTGGLYTYLEEVYGEFWGFLCGWVQIIIYGPAIIGALGLYFGSLMAN
LFGWGSGLSKVIGIIAVLFLCVINIIGTKYGGFVQTLTTIGKLIPIACIIVFGLWKGDQH
IFTAVNESISDMNFGAAILATLFAYDGWILLAALGGEMKNPEKLLPRAMTGGLLIVTAIY
IFINFALLHILSANEIVTLGENATSTAATMLFGSIGGKLISVGIIVSIFGCLNGKVLSFP
RVSFAMAERKQLPFAEKLSHVHPSFRTPWIAISFQIALALIMMLISNPDKLSEISIFMIY
IFYVMAFFAVFILRKRAKGEKRAYSVPLYPFMPILAIAGSFFVLGSTLITDTMSCGLSIL
IGLAGLPVYYGMKKRKAS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcatactgaagacaacggtttgaaaaaagagataggcctcttgtttgcccttactctt
gtcatcggaaccattatcggttctggtgtttttatgaagcccggcgctgtgcttgcttat
tcaggtgattcaaaaatggcgcttttcgcctggctgttaggcggtattttaacactggcg
ggcggtttgacaatcgcggaaatcggaacgcagattccaaaaaccggcgggctttatacg
taccttgaagaagtgtacggcgagttttggggatttttgtgcggctgggtgcagattatc
atttacggcccggcgattattggcgcgctgggtttatattttggatctttaatggcgaat
cttttcggctggggatctggactatcaaaagtcattggaattatagcagttctcttttta
tgcgtcattaatattatcggtacaaaatacggcggttttgtccaaacgctgacaacgatc
ggaaaactgattccgattgcctgcatcatcgtctttggcctttggaaaggcgatcagcac
atcttcacagcagtaaacgaaagcatttctgatatgaacttcggggcggctattttagct
acgttgtttgcttatgacggatggattctccttgccgctctcggcggagaaatgaaaaat
cccgaaaagctgctgccacgcgctatgacgggcggattattaattgtaacggcgatctat
attttcattaattttgcattgcttcacatcctgtcagcgaacgaaattgtcacgcttggt
gaaaatgcgacaagcaccgctgcaaccatgctgttcggttcaattggcggaaagctgatc
agtgtagggattatcgtcagcatctttgggtgcttaaatggaaaggtgctttctttcccg
cgtgtttcatttgcaatggcggaacgcaaacagcttccatttgctgaaaaactgtcacat
gtacacccgtcgttccgcacaccatggattgcgatttcttttcaaattgctttggctttg
attatgatgctgatcagcaaccctgataagctctcagaaatctccattttcatgatctac
attttttatgtgatggccttttttgcagtgtttattctccgcaagcgagcaaagggagaa
aagcgcgcctacagtgttccgctttatccatttatgccaattctggcaatcgcgggctcc
ttctttgtgttaggcagcacactcattacagatacaatgagctgcggattatccatcctc
atcggccttgccggactgcctgtttattacgggatgaaaaaacgaaaagcaagctga

DBGET integrated database retrieval system