KEGG   Bacillus subtilis subsp. subtilis 168: BSU12880
Entry
BSU12880          CDS       T00010                                 

Gene name
ykcB
Definition
(RefSeq) mannosyltransferase YkcB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PMT_2 PMT SpoIIIAC
Other DBs
NCBI-GeneID: 939775
NCBI-ProteinID: NP_389171
Pasteur: BG13229
BSORF: BG13229
UniProt: O34575 A0A6M3ZDC6
Position
1354285..1356435
AA seq 716 aa
MEKKKRELDIVLLLILLASAFLNIYNIWKDDTVNPYYTAAVTSMMQSFHNFFYASFDAAG
FITVDKPPVTYQIQTISALIFGMHGWSVILPQALAGVGSVLLMYLLIKPTFGKTAARIAS
FVMACTPIAVAVARTNNVDALLVFFLLLATWLLFKAIRKGKLIWLLAAFFVVGVGFNTKM
LQAYMILPAFLLFYLIAANATIKKKIVSLVSALAVLAAVSLSWPLIVDNIPASKRPYIGS
SQTNSVLELAFGYNGIQRLTGQNSGGGQGAPNKDASKEMSSSDNTQAPPNQSSSNSSSSD
GKSSNGNMAAPPSNGQMPSGGQGGPPSGGDGGQGGPGGDGGKGGTGTGSKMQSGSGMFGT
GTPGPLRLFQQELSDQISWLLPFAIFGIAGLLIAGARERRRLSVEQKETVFWVAWLVPIA
GFFSVAEFFHHYYLIMLAPPIAALVGAGWVALVHLYRNQTGWKAWLLPGAIIATTGFELF
ILRNYNDQIGVGWSIGVGVIGVLSAIALLLFKQRQKPFSYYVSLAALLALLVMPMYWAST
PLLYGGNSSLPETGPQLASMSGKGMGMSDATVNEKLIKYLEENNSGAEYLFATTDSNTAA
PYIIKTKKAVMAIGGYSGSDPAITLTQFKKLVKEGKVKYFLASGMGRGGNNDIVEWVEKN
GKEVASEKWQSSSDQKTENTDSADTSSSKASGENGKMGGPGGMNQSATLYELHADE
NT seq 2151 nt   +upstreamnt  +downstreamnt
gtggaaaagaaaaaacgcgagctggatatcgtcctcctcctcattttgctcgcatctgca
ttcttaaatatctataacatttggaaggacgacacggtgaatccttattacaccgcggca
gttacaagtatgatgcaaagctttcataatttcttttatgcttcgttcgatgctgccggc
tttataacagtagataaaccgcctgttacataccaaatccaaacgatcagcgcactgata
ttcggtatgcacggctggagcgtcatcctgcctcaggcacttgctggtgtaggttctgtc
cttcttatgtacttgctgataaagccgacatttggaaaaacggcggcgcgtattgcctca
tttgttatggcatgtacgccgatagctgtagctgtagcacgtacaaacaatgttgatgca
ttactggtatttttcttattgcttgctacatggcttctctttaaagcgatcagaaaagga
aagctgatctggctgttagcagcatttttcgttgttggagtaggttttaatacaaaaatg
ctgcaggcttacatgattttaccggctttcttattgttctatctgattgcggcaaacgcc
acaatcaagaaaaaaatcgtttcattggtaagtgcgttagccgtattagcagccgtttcg
ttatcgtggccgctcattgttgacaatatccctgcaagcaagcggccttatatcggaagc
agccaaaccaactctgttttggaattggctttcggctataacggaatccagcggctgaca
ggccaaaattcaggcggcggccagggtgcgccaaacaaagacgcttcaaaagaaatgtct
tcttctgataacactcaagcaccgcctaatcagtcatcaagcaacagctcatcaagcgat
ggtaaatcctcaaatggcaatatggcggcgcctccatccaatggccaaatgccaagcggc
ggtcaaggaggccctccaagcggcggagatggcggccaaggcggacccggcggagacgga
gggaaaggcggtacaggaaccggttcgaaaatgcaatcaggttcagggatgtttggaacg
ggaacacctggtccactgcggcttttccaacaagagttatctgatcaaatcagctggctt
ctgccatttgcgatatttggaatcgcaggcttactgatcgctggcgcaagagaaagaaga
agattatctgtagagcagaaggaaacggtgttctgggttgcgtggcttgtaccgattgcc
ggattcttcagtgtcgcagaatttttccatcattattatctcatcatgctggcaccgccg
attgcggctcttgtcggtgcggggtgggtcgctcttgttcatctgtaccgcaatcagaca
ggctggaaagcatggcttttgccgggagcaattattgcgacaactggatttgaattgttt
attctcagaaactacaacgatcaaatcggtgttggatggagtatcggggtaggtgttatc
ggcgtgttgtcagcgattgctttgctgctgtttaaacagcgccaaaaaccgttcagttat
tatgtttcacttgcagctctcctcgcattgctggtgatgccgatgtattgggcaagtaca
ccgcttctgtacggaggcaacagctcactgcctgaaacaggccctcaactcgcatcaatg
agcggaaaaggcatgggaatgtctgatgcgactgtaaatgaaaaactgatcaaatatcta
gaggagaataactccggagctgaatacctattcgccacaaccgattcgaacacagcggca
ccatatatcattaaaacgaaaaaagctgtcatggctattggtggatacagcggttctgac
ccggcaatcacactgactcaattcaaaaaacttgtaaaagaaggaaaagtgaaatacttc
ttggcttctggaatgggaagaggcggaaacaatgacattgttgaatgggttgagaaaaat
ggaaaagaagtagcatcagaaaaatggcaatcaagttctgatcaaaaaacagaaaatact
gattcagctgatacatcaagcagcaaggcttcaggtgaaaacggcaaaatgggcggacct
ggcggaatgaatcagtcagcaacattatacgaactacatgctgatgaatag

DBGET integrated database retrieval system