KEGG   Bacillus subtilis subsp. subtilis 168: BSU12890Help
Entry
BSU12890          CDS       T00010                                 

Gene name
ykcC
Definition
(RefSeq) glycosyltransferase YkcC
  KO
K20534  polyisoprenyl-phosphate glycosyltransferase [EC:2.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
    BSU12890 (ykcC)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12890 (ykcC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     BSU12890 (ykcC)
Lipopolysaccharide biosynthesis proteins [BR:bsu01005]
 O-antigen
  BSU12890 (ykcC)
Transporters [BR:bsu02000]
 Other Transporters
  Others
   BSU12890 (ykcC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_4 THUMP
Motif
Other DBs
NCBI-GeneID: 936326
NCBI-ProteinID: NP_389172
Pasteur: BG13230
BSORF: BG13230
UniProt: O34319
Position
1356447..1357418
Genome map
AA seq 323 aa AA seqDB search
MSRHIQYSIVVPVYNEELVIHETYQRLKEVMDQTKENYELLFVNDGSKDRSIEILREHSL
IDPRVKIIDFSRNFGHQIAITAGMDYAQGNAIVVIDADLQDPPELILEMIEKWKEGYEVV
YAVRTKRKGETFFKKQTAAMFYRLLSGMTDIDIPIDTGDFRLMDRKVCDEMKRLKEKNPF
VRGLVSWVGFKQTAVEYVRDERLAGETKYPLKKMLKLSMDGITTFSHKPLKLASYAGILM
SGTGFLYMFIVLYLKLFTDSTITGWSSLIVIQLLFSGIVLLILGVIGEYIGRIYDEAKDR
PLYIVQKSYGIENKRLYRDQHMS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacatattcaatattcaattgttgtacctgtgtataatgaagagcttgtcatt
catgaaacctatcagcgcttaaaagaggtcatggatcaaacgaaggaaaactacgagctg
ctttttgtcaacgatggcagcaaagaccgcagtattgagattttaagagagcacagcctg
atcgatccgagagtgaaaattattgatttttcaaggaattttggacatcagatcgccatt
acggcaggtatggattatgcacaggggaatgcaatcgtcgtcattgacgccgatttgcag
gaccctcctgaactgattttagaaatgattgaaaagtggaaggaaggctatgaagtcgtg
tacgccgtacggactaaacgaaaaggggaaacctttttcaaaaaacaaaccgcggctatg
ttttaccggcttctcagcggtatgacagatattgatatcccgattgatacgggggatttt
cgcctcatggacagaaaagtctgtgatgaaatgaagagattaaaagaaaaaaatccattt
gtaagagggctagtcagctgggtgggtttcaaacagacagcggtcgagtatgtacgtgat
gaaaggctcgccggagaaacaaagtacccgctcaagaaaatgctgaagctgtcaatggac
ggcatcacgacattttcacataaaccgctgaagctggcaagctatgcggggattttaatg
tcaggtactggatttctgtatatgtttatcgtgctgtatctgaagctattcacagacagc
acgattaccggctggtcatcacttattgtgatccagctcctgttcagcggcattgtcctt
ctgattttgggcgtgattggcgaatatatcggcagaatctacgatgaagccaaagacagg
ccgctttacatcgtccaaaaatcgtatggaattgaaaataaaagactctatagagaccag
catatgtcataa

DBGET integrated database retrieval system