KEGG   Bacillus subtilis subsp. subtilis 168: BSU12920
Entry
BSU12920          CDS       T00010                                 

Symbol
dppA
Name
(RefSeq) D-aminopeptidase
  KO
K16203  D-amino peptidase [EC:3.4.11.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU12920 (dppA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     BSU12920 (dppA)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M55: DppA aminopeptidase family
   BSU12920 (dppA)
SSDB
Motif
Pfam: Peptidase_M55
Other DBs
NCBI-GeneID: 936727
NCBI-ProteinID: NP_389175
Pasteur: BG10842
BSORF: BG10842
UniProt: P26902 A0A6M4JMA4
Structure
Position
1360401..1361225
AA seq 274 aa
MKLYMSVDMEGISGLPDDTFVDSGKRNYERGRLIMTEEANYCIAEAFNSGCTEVLVNDSH
SKMNNLMVEKLHPEADLISGDVKPFSMVEGLDDTFRGALFLGYHARASTPGVMSHSMIFG
VRHFYINDRPVGELGLNAYVAGYYDVPVLMVAGDDRAAKEAEELIPNVTTAAVKQTISRS
AVKCLSPAKAGRLLTEKTAFALQNKDKVKPLTPPDRPVLSIEFANYGQAEWANLMPGTEI
KTGTTTVQFQAKDMLEAYQAMLVMTELAMRTSFC
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaaattgtacatgtcagtagatatggaaggtatttcgggtcttccggacgataccttt
gtggattccggcaagcggaattatgaacgcggacggcttatcatgactgaagaagcaaac
tactgtattgctgaagcgtttaacagcgggtgtaccgaggtgctggtcaatgacagtcat
tcgaagatgaataatctgatggttgaaaagcttcaccctgaagcagacttgatttctggt
gacgtcaaaccattttcaatggtggagggactggatgatacgtttagaggcgctttgttt
ctcggttatcatgcgagagcctcgactcctggtgtcatgtcacacagcatgattttcggc
gtccgtcatttttacataaacgatcggcctgtcggtgagcttggattaaatgcatacgtt
gccggttattatgatgtcccggtattaatggtagccggggatgaccgggcggcgaaggaa
gcagaagagcttatcccgaacgtgacgacagccgcagtcaaacaaaccatttcaagatcc
gcagtgaagtgcttgtcgcctgcgaaagccggacggctgttgacagaaaaaaccgcattt
gccctgcaaaacaaggacaaagtcaagccgctcacaccgcctgacaggccagttctgagc
attgaattcgccaattatggccaagcagaatgggcgaatctgatgccgggaacggaaatc
aagacgggaactacaaccgttcaatttcaggcgaaggacatgcttgaagcctatcaggcg
atgcttgtcatgactgagcttgcgatgcggacatcattctgctaa

DBGET integrated database retrieval system