KEGG   Bacillus subtilis subsp. subtilis 168: BSU12930
Entry
BSU12930          CDS       T00010                                 

Gene name
dppB
Definition
(RefSeq) dipeptide transport system permease protein DppB
  KO
K16200  dipeptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU12930 (dppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12930 (dppB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    BSU12930 (dppB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N DUF3687 DUF1467
Other DBs
NCBI-GeneID: 939881
NCBI-ProteinID: NP_389176
Pasteur: BG10843
BSORF: BG10843
UniProt: P26903 A0A6M3ZA25
Position
1361242..1362168
AA seq 308 aa
MARYMIKRFWAMAATILVITTLTFVLMKVIPGSPFNEERGTNEAVQKNLEAYYHLDDPLI
FQYIFYLKSIITFDFGPSIKKPSDSVNDMLERGFPVSFELGMTAIVIAVISGLVLGVIAA
LRRNGFLDYAAMSLAVLGISIPNFILATLLIQQFAVNLKLFPAATWTSPIHMVLPTAALA
VGPMAIIARLTRSSMVEVLTQDYIRTAKAKGLSPFKIIVKHALRNALMPVITVLGTLVAS
ILTGSFVIEKIFAIPGMGKYFVESINQRDYPVIMGTTVFYSVILIIMLFLVDLAYGLLDP
RIKLHKKG
NT seq 927 nt   +upstreamnt  +downstreamnt
ttggcgcgatacatgataaagcgtttttgggcaatggcagctacgattttggtgattacc
accctgacttttgttctcatgaaggtcattcccggatctccttttaacgaggagagaggc
acaaatgaagccgttcaaaaaaatctcgaagcctactatcacttagacgatcctctcatt
ttccaatacattttctacttaaaatccatcattacattcgatttcggaccttcaattaaa
aaaccgtcggacagcgtaaatgatatgctggaacgcggatttcccgtttcctttgagctt
gggatgacagcgattgtcattgctgtgatttctgggctggtgctgggcgtaatcgctgca
ctccgccgcaatggctttttggactacgccgcgatgagtcttgcagtactcggcatctcc
atcccgaattttattctggcaacattgctcattcagcaatttgctgtcaatctcaaacta
tttcccgctgcgacatggacgagcccgattcatatggtgcttccgaccgcagcgcttgct
gtagggccaatggcgatcattgccaggctgacacggtcgagcatggtcgaagttctgaca
caggattatatccgcacagcaaaagcaaaagggctttctccgttcaaaattatcgtaaaa
cacgcactcagaaatgcactcatgcccgtcattaccgtcctgggcacactcgtcgccagc
atcttaacaggaagctttgtcattgaaaaaatctttgccattccgggaatgggaaaatat
tttgttgaaagcattaatcagcgggactaccccgtgattatgggaacgaccgttttttac
agcgtcattctgattatcatgctgtttttggtcgatttggcctacggtctcttagacccg
cgcattaaactgcataagaaagggtga

DBGET integrated database retrieval system