KEGG   Bacillus subtilis subsp. subtilis 168: BSU12940
Entry
BSU12940          CDS       T00010                                 

Gene name
dppC
Definition
(RefSeq) dipeptide transport system permease protein DppC
  KO
K16201  dipeptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU12940 (dppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12940 (dppC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    BSU12940 (dppC)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N DUF2631
Other DBs
NCBI-GeneID: 938038
NCBI-ProteinID: NP_389177
Pasteur: BG10844
BSORF: BG10844
UniProt: P26904 A0A6M3Z9Q6
Position
1362174..1363136
AA seq 320 aa
MNLPVQTDERQPEQHNQVPDEWFVLNQEKNREADSVKRPSLSYTQDAWRRLKKNKLAMAG
LFILLFLFVMAVIGPFLSPHSVVRQSLTEQNLPPSADHWFGTDELGRDVFTRTWYGARIS
LFVGVMAALIDFLIGVIYGGVAGYKGGRIDSIMMRIIEVLYGLPYLLVVILLMVLMGPGL
GTIIVALTVTGWVGMARIVRGQVLQIKNYEYVLASKTFGAKTFRIIRKNLLPNTMGAIIV
QMTLTVPAAIFAESFLSFLGLGIQAPFASWGVMANDGLPTILSGHWWRLFFPAFFISLTM
YAFNVLGDGLQDALDPKLRR
NT seq 963 nt   +upstreamnt  +downstreamnt
gtgaatctccctgtacaaacggatgaacgccagccagaacagcacaatcaggtgcctgat
gagtggtttgtcttgaatcaggaaaaaaatcgggaagccgattcggtcaagcggccgagt
ttgtcatacacgcaggatgcctggaggaggctgaaaaaaaataaattagcgatggccgga
ctctttattcttttatttctttttgtcatggcagttatcgggccctttttatcgccccat
agtgtcgtacgccaatcgctgacagaacaaaatcttccgccctcagccgatcattggttc
ggcaccgatgaactcggccgggatgtgtttacccgaacatggtatggcgcgagaatctcg
ttgtttgtcggcgtgatggcagcactgattgattttttgatcggtgtcatttacggaggc
gttgccggctataaaggcggcaggattgacagcattatgatgcggattatcgaagtgctg
tacggactgccgtatctgcttgttgtcattttgctgatggtgctcatgggaccgggactg
ggcacgattattgtggcgctgactgtgaccgggtgggtcggcatggcgagaattgtaaga
ggccaggtgcttcagattaaaaattatgaatatgtactcgcctcgaaaacctttggcgcg
aaaacctttcgcatcatccggaagaatttgctgccgaatactatgggagcgatcatcgta
caaatgacattaaccgtacctgccgccatattcgcagaatcatttttaagctttctcggc
ctgggcatacaggctccgtttgcaagttggggcgtgatggcgaatgacggcctgcctacg
attttatctgggcattggtggcgcctgttttttccggcctttttcatatctctgacgatg
tacgcgtttaatgtgctgggggacggattgcaggatgcgcttgaccctaagctgaggagg
tag

DBGET integrated database retrieval system