KEGG   Bacillus subtilis subsp. subtilis 168: BSU12950Help
Entry
BSU12950          CDS       T00010                                 

Gene name
dppD
Definition
(RefSeq) dipeptide transport ATP-binding protein DppD
  KO
K16202  dipeptide transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00566  Dipeptide transport system, Firmicutes
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU12950 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12950 (dppD)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Dipeptide transporter [MD:M00566]
    BSU12950 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 ATP-synt_ab Mg_chelatase ABC_ATPase AAA_29
Motif
Other DBs
NCBI-GeneID: 938628
NCBI-ProteinID: NP_389178
Pasteur: BG10845
BSORF: BG10845
UniProt: P26905
Position
1363141..1364148
Genome map
AA seq 335 aa AA seqDB search
MEKVLSVQNLHVSFTTYGGTVQAVRGVSFDLYKGETFAIVGESGCGKSVTSQSIMGLLPP
YSAKVTDGRILFKNKDLCRLSDKEMRGIRGADISMIFQDPMTALNPTLTVGDQLGEALLR
HKKMSKKAARKEVLSMLSLVGIPDPGERLKQYPHQFSGGMRQRIVIAMALICEPDILIAD
EPTTALDVTIQAQILELFKEIQRKTDVSVILITHDLGVVAQVADRVAVMYAGKMAEIGTR
KDIFYQPQHPYTKGLLGSVPRLDLNGAELTPIDGTPPDLFSPPPGCPFAARCPNRMVVCD
RVYPGQTIRSDSHTVNCWLQDQRAEHAVLSGDAKD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttctgtcagtccaaaatctgcacgtgtcttttacgacttacggcgggacg
gttcaggcggtcagaggggtgagctttgatttgtataaaggagaaacctttgcgatcgtc
ggcgaatccggctgcggcaaaagcgttacctcccaaagcatcatgggcctgcttccgcct
tattcggcgaaggtgacagacggcaggattctatttaaaaacaaagacctttgccgtctc
tctgacaaagaaatgagaggtataaggggagccgacatttctatgatttttcaagacccg
atgacggcgttaaaccctacgctgactgtcggcgaccagctgggggaagcgctattgcgc
cacaaaaaaatgagcaaaaaagcggcacggaaagaggtgctttccatgctgtcattggtt
ggtattccagatcccggagagcgcctaaagcaatatccccaccaattcagcggcggtatg
agacagcggattgtcattgcgatggcgctgatttgcgagcctgatatcttaattgcggat
gaaccgaccaccgccctggatgtaaccattcaggcacagattttagagctgtttaaagag
attcagagaaaaacggatgtgtctgtcattctgattacgcacgatttaggggttgttgcc
caggtagctgacagagtcgcagtcatgtatgccgggaaaatggcggaaatcggcacaaga
aaagatattttttatcagccgcagcacccatatacaaaaggcctgctgggctctgtcccg
cggctggatttaaatggcgctgagctgaccccgattgacggaacgccgccggatttattt
tcgcctccgccgggctgcccgtttgccgcccgctgtccgaacaggatggttgtgtgtgac
agggtgtacccgggccagacgatcagatctgactcgcacaccgtcaactgctggctgcag
gatcaacgagcagagcatgcggtgctgtcaggagatgcgaaggattga

DBGET integrated database retrieval system