KEGG   Bacillus subtilis subsp. subtilis 168: BSU12960
Entry
BSU12960          CDS       T00010                                 

Gene name
dppE
Definition
(RefSeq) dipeptide ABC transporter substrate-binding protein
  KO
K16199  dipeptide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU12960 (dppE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12960 (dppE)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    BSU12960 (dppE)
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-GeneID: 938099
NCBI-ProteinID: NP_389179
Pasteur: BG10846
BSORF: BG10846
UniProt: P26906 A0A6M3ZIL0
Position
1364151..1365800
AA seq 549 aa
MKRGKRMKRVKKLWGMGLALGLSFALMGCTANEQAGKEGSHDKAKTSGEKVLYVNNENEP
TSFDPPIGFNNVSWQPLNNIMEGLTRLGKDHEPEPAMAEKWSVSKDNKTYTFTIRENAKW
TNGDPVTAGDFEYAWKRMLDPKKGASSAFLGYFIEGGEAYNSGKGKKDDVKVTAKDDRTL
EVTLEAPQKYFLSVVSNPAYFPVNEKVDKDNPKWFAESDTFVGNGPFKLTEWKHDDSITM
EKSDTYWDKDTVKLDKVKWAMVSDRNTDYQMFQSGELDTAYVPAELSDQLLDQDNVNIVD
QAGLYFYRFNVNMEPFQNENIRKAFAMAVDQEEIVKYVTKNNEKPAHAFVSPGFTQPDGK
DFREAGGDLIKPNESKAKQLLEKGMKEENYNKLPAITLTYSTKPEHKKIAEAIQQKLKNS
LGVDVKLANMEWNVFLEDQKALKFQFSQSSFLPDYADPISFLEAFQTGNSMNRTGWANKE
YDQLIKQAKNEADEKTRFSLMHQAEELLINEAPIIPVYFYNQVHLQNEQVKGIVRHPVGY
IDLKWADKN
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgaaaagggggaagaggatgaaacgagtgaaaaagctatggggcatgggtcttgcatta
ggactttcgtttgcgctgatggggtgcacagcaaatgaacaggccggaaaagaaggcagt
catgataaggcaaaaaccagcggagaaaaggtgctgtatgtaaataatgaaaatgaaccg
acttcattcgatccgccgatcggctttaataatgtgtcatggcagccgttaaataacatc
atggaggggctgacgcgtcttggcaaagatcatgagcccgagccggcaatggcggagaaa
tggtctgtttcgaaagataataaaacttacacatttacgattcgggaaaatgcgaaatgg
acaaacggagatcctgtaacagccggagacttcgaatacgcgtggaagcggatgcttgat
ccgaaaaaaggcgcttcatcggcattcctaggttattttattgaaggcggcgaagcatat
aacagcgggaaagggaaaaaagacgatgtgaaggtgacggcaaaggatgatcgaaccctt
gaagttacactggaagcaccgcaaaaatatttcctgagcgttgtgtccaatcccgcgtat
ttcccggtaaatgaaaaggtcgataaagacaatccaaagtggtttgctgagtcggataca
tttgtcggaaacggcccgtttaagctgacggaatggaagcatgatgacagcatcacaatg
gagaaaagcgacacgtattgggataaggatacagtgaagcttgataaggtgaaatgggcg
atggtcagtgacagaaatacagattaccagatgtttcaatcaggggaacttgataccgct
tatgtccctgctgagctgagtgatcagctgcttgatcaggataacgtcaatattgttgac
caggcgggtctctatttctatcgatttaatgtcaacatggagccgttccaaaatgaaaac
atcagaaaagcctttgcgatggctgtggatcaagaggaaattgtaaagtacgtcacgaaa
aataatgaaaaaccggcgcacgcctttgtatcgcctgggtttacgcagcctgacggcaaa
gatttccgtgaagcaggcggagacctgatcaagcctaacgaaagcaaagcgaagcagctg
ctcgaaaagggcatgaaggaagaaaactataataagcttcctgcgatcacgcttacttac
agcacaaagccggagcataaaaagattgccgaagctattcagcaaaaattgaaaaatagc
cttggagtcgatgtgaagctggccaatatggaatggaacgtatttttagaggatcaaaaa
gcgctgaaattccaattctctcaaagctcatttttgcctgattatgcagaccctatcagt
tttctggaagcctttcaaacgggaaattcgatgaaccgcacaggctgggccaataaagaa
tacgatcagctgatcaaacaggcgaaaaacgaagccgatgaaaaaacacggttctctctt
atgcatcaagctgaagagctgctcatcaatgaagcgccgatcattccggtttatttttat
aatcaggttcacctgcaaaatgaacaagtaaaaggaattgtccgtcaccctgtcggctat
atcgatttaaaatgggcagataaaaactga

DBGET integrated database retrieval system