KEGG   Bacillus subtilis subsp. subtilis 168: BSU12970Help
Entry
BSU12970          CDS       T00010                                 

Gene name
ykfA
Definition
(RefSeq) murein peptide carboxypeptidase
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU12970 (ykfA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU12970 (ykfA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     BSU12970 (ykfA)
Peptidases [BR:bsu01002]
 Serine Peptidases
  Family S66
   BSU12970 (ykfA)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Carboxypeptidase
   BSU12970 (ykfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Motif
Other DBs
NCBI-GeneID: 938175
NCBI-ProteinID: NP_389180
Pasteur: BG13231
BSORF: BG13231
UniProt: O34851
Position
1365888..1366847
Genome map
AA seq 319 aa AA seqDB search
MKGVFSLNYKPKALNKGDTVGVIAPASPPDPKKLDTALLFLEELGLQVKLGKALKNQHGY
LAGQDDERLADLHEMFRDDEVKAVLCACGGFGTGRIAAGIDFSLIRKHPKIFWGYSDITF
LHTAIHQNTGLVTFHGPMLSTDIGLDDVHPLTKASYKQLFQETEFTYTEELSPLTELVPG
KAEGELVGGNLSLLTSTLGTPFEIDTRGKLLFIEDIDEEPYQIDRMLNQLKMGGKLTDAA
GILVCDFHNCVPVKREKSLSLEQVLEDYIISAGRPALRGFKIGHCSPSIAVPIGAKAAMN
TAEKTAVIEAGVSEGALKT
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagtgttttcgttgaattacaagccgaaagcgttgaacaagggtgatacagtc
ggagtgatcgcgcccgcaagtccgccggatccaaaaaagcttgacaccgcgcttttattt
ttagaagagctcggtcttcaggtgaagttgggcaaggcgctgaaaaaccagcacggctat
ttagcgggacaggatgatgagcggctggcggatctccatgagatgttcagagacgatgag
gtaaaagcagtgttgtgcgcatgcgggggttttgggacaggacgtatcgccgcgggcatt
gatttcagcttgatccgcaaacaccctaaaatcttttggggatacagcgatattacgttt
ttacatactgccattcatcaaaacacaggtcttgtcactttccatggcccgatgctcagc
acggatattggccttgacgacgttcacccgctgacaaaagcgtcatataagcagctcttc
caggagacggaattcacctatacagaagagctttctccgctgaccgagcttgttcctgga
aaagcggaaggcgagcttgtcgggggaaatctgtctttgctgacgtctacactgggcacg
ccatttgaaattgatacgagaggaaagcttctgtttattgaagatattgacgaggagcct
tatcaaatcgaccggatgctgaatcagctgaaaatgggggggaagctgacggacgcggcg
ggaattctagtttgtgattttcacaattgtgtcccggtgaagcgagagaagtctctctcg
cttgagcaggtgctggaagactatattatttctgcgggcaggcctgctctgagaggattt
aaaatcggccactgctcgccaagtattgccgttccgatcggtgcgaaagctgctatgaat
acagcagaaaaaacagccgtaatagaggcgggcgtttcagaaggggcgctgaagacatga

DBGET integrated database retrieval system