KEGG   Bacillus subtilis subsp. subtilis 168: BSU12980
Entry
BSU12980          CDS       T00010                                 

Gene name
ykfB
Definition
(RefSeq) L-Ala-D/L-Glu epimerase
  KO
K19802  L-Ala-D/L-Glu epimerase [EC:5.1.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU12980 (ykfB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.20  L-Ala-D/L-Glu epimerase
     BSU12980 (ykfB)
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C DUF520
Other DBs
NCBI-GeneID: 939862
NCBI-ProteinID: NP_389181
Pasteur: BG13232
BSORF: BG13232
UniProt: O34508 A0A6M3ZIP7
Structure
PDB: 
1TKK 1JPM

Position
1366844..1367944
AA seq 366 aa
MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVITGDSMD
SIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLY
QMLGGYRDTLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRK
RVGSAVKLRLDANQGWRPKEAVTAIRKMEDAGLGIELVEQPVHKDDLAGLKKVTDATDTP
IMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIET
KLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGITYSGSTISMPGKPGLGIIGAALL
KGEKEQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaaaatcattcgaatcgaaacaagccgaatcgctgtcccgctgacaaagccgtttaaa
accgcacttcgcactgtgtatacggctgaatcagtcatagtaaggattacttatgacagc
ggtgcagtcggatggggagaagcacccccgacgttagtgattacaggagacagcatggat
agcattgaaagtgccatccaccatgtgttgaagccggcattgcttggaaaaagcctggcg
ggctatgaggccattctgcacgacatccagcatcttcttacaggaaatatgagcgcgaag
gctgctgtagaaatggctctatacgacggctgggcgcagatgtgcgggctgccgctttat
caaatgcttggcggatatcgagatacgctggaaacagattatactgtcagtgtcaactca
cctgaagagatggcagctgatgccgagaattatctcaaacaaggctttcaaacgctgaaa
ataaaggtcggaaaagatgatattgcaacagatatcgcccgtatccaggaaatcagaaaa
cgtgtcggatcagctgtgaaactgcgtttagacgctaatcaggggtggaggccgaaggaa
gcggtaactgccattcggaaaatggaggatgcgggcctaggcattgagcttgtcgagcag
cctgtccataaagatgatctcgctgggcttaaaaaggtgacagatgcaacagatacgccg
attatggctgatgaaagtgtttttacaccgcgccaggcgttcgaagttctgcaaacccgg
agcgcagacttgatcaatattaaattgatgaaagcgggcggcatcagcggagcagagaaa
attaatgccatggcggaggcctgcggggtggagtgtatggtcggcagcatgatcgaaacg
aagctgggcattacggccgcggcgcattttgcggcaagcaagagaaacatcacacgcttt
gattttgacgcgccgctgatgctgaaaacagatgtattcaatggcggcataacatatagc
ggcagcacgatttcgatgcctggcaaaccgggcctcggaatcatcggggctgcgcttttg
aaaggggaaaaagagcaatga

DBGET integrated database retrieval system