KEGG   Bacillus subtilis subsp. subtilis 168: BSU12990
Entry
BSU12990          CDS       T00010                                 

Gene name
ykfC
Definition
(RefSeq) gamma-D-glutamyl-l-lysine endopeptidase
  KO
K20742  gamma-D-glutamyl-L-lysine dipeptidyl-peptidase [EC:3.4.14.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU12990 (ykfC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.13  gamma-D-glutamyl-L-lysine dipeptidyl-peptidase
     BSU12990 (ykfC)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C40
   BSU12990 (ykfC)
SSDB
Motif
Pfam: NLPC_P60 SH3_16 CHAP
Other DBs
NCBI-GeneID: 937979
NCBI-ProteinID: NP_389182
Pasteur: BG13233
BSORF: BG13233
UniProt: O35010 A0A6M3Z9U6
Position
1367941..1368831
AA seq 296 aa
MMHTVISAVANIWTAPDSPRPSDQFMLQPTVMIRDWLERMTYDERLGLCTDNVIQTQVLF
GEKVLVTAEQGEWVSVIVPSQPSRKDPRGYPGWMKKYQLEKTKPIHTQHDVMISKPAAFL
YRSNGEKEIELSFLTVLPLIAKENGYFKVSTVFGERFVRQSDAVPVSQQKGTAEDIIQTG
AFFLGLPYLWGGISGFGFDCSGFMYSIFKANGYSIPRDAGDQAKAGKGVPLDDMKAGDLL
FFAYEEGKGAIHHVGLYVGGGKMLHSPKTGKSIEILTLTETIYEKELCAVRRCFSE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgatgcacactgtcatatcagcagtggccaacatctggacagcgcctgattcacctcgt
ccgtctgatcaattcatgcttcaaccgactgtaatgatcagagactggctggagcgcatg
acgtatgatgaacggcttggattatgtacagacaatgtaatccaaactcaggttctcttt
ggcgaaaaggtacttgtgacggcggaacagggggaatgggtttctgtgatcgtgcctagc
cagccatcccgaaaggatccgcgcggatacccgggctggatgaaaaagtaccagctggaa
aaaacaaagcccatccatacacaacacgatgtgatgatcagcaaacctgctgcctttttg
tacagaagcaatggggaaaaggagatcgaattaagctttttgacagttctgccccttatt
gcaaaagaaaacggatattttaaggtttcgaccgtttttggggaaaggtttgtgaggcaa
agtgatgcagtgcctgtcagccaacagaaagggactgctgaagacatcattcaaacgggt
gcgttttttcttggccttccctacctgtggggagggatcagcgggtttgggtttgattgc
tccggatttatgtacagtatatttaaggcgaatggatacagcatcccccgtgatgcggga
gatcaggctaaggcagggaagggtgtcccgcttgatgatatgaaagccggtgatctgctg
ttttttgcttatgaggaaggaaaaggagcgattcatcacgtcggtctgtatgtaggcggc
gggaaaatgcttcattctccaaagacagggaagtcaatcgaaatcctcacattaacagag
acaatctatgaaaaagaattatgtgcggtgcgccgctgtttttcagaataa

DBGET integrated database retrieval system