KEGG   Bacillus subtilis subsp. subtilis 168: BSU13010Help
Entry
BSU13010          CDS       T00010                                 

Gene name
ykgB
Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01200  Carbon metabolism
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU13010 (ykgB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     BSU13010 (ykgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase
Motif
Other DBs
NCBI-GeneID: 937980
NCBI-ProteinID: NP_389184
Pasteur: BG13236
BSORF: BG13236
UniProt: O34499
Position
complement(1369876..1370925)
Genome map
AA seq 349 aa AA seqDB search
MTKYIGYVGTYTKGGSEGIYSFELDTEKKALSEPKLAAKLGNPTYVATNKNNTILYSIEK
ADGQGGVAAYQIDKNSGELTFLNHQLIDGPSPCHVSVDDQNQFVLTANYHSGKVHVFPVQ
EDGSLQSPVSEAAHTGKGPHERQEKPHTHYAGFTPEHNYVVAVDLGIDKLYTYKLKDGVL
TESGSHSFAPGAGPRHIAFHPKEKYAYVMTELSNEVIALEYNPTAGEFREIQVVSAIPDD
FTDNSQGSAIHVTQDGRFVYVANRGHDSIAVFEVNQYSGELAFVERVSTEGNWPRDFVFD
PTEGFLVASNEETGNLVLFERDKETGRLTLLPSTVSVPYPVCVKFLHQV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatacataggatatgtgggaacatatacaaaaggcggaagcgaaggaatttat
tcatttgagcttgatactgagaaaaaagcactcagcgagccaaagctggccgctaagctg
ggcaacccgacatatgtggcgacgaataaaaacaacaccatcctttattccatcgaaaaa
gcagacggccaaggcggagttgctgcctatcaaatcgataaaaacagcggcgaattgaca
tttctgaatcatcagttaattgatggcccttcgccatgccacgtaagcgttgatgatcaa
aatcaattcgtactgactgccaattatcacagcgggaaggtacacgtttttccggttcag
gaagacggcagcttgcaatcacctgtttcagaggccgctcacacaggaaaagggccgcac
gaaagacaagaaaaaccgcatacacactacgcggggttcacacctgaacacaattatgtg
gtagcggttgatttaggtatagataagctctacacctataagcttaaagacggtgtgttg
actgaatccggaagccattccttcgctcccggtgcaggacctcgccatatcgcttttcat
ccgaaagaaaaatacgcttatgtcatgacagaattaagcaatgaagtgattgcgcttgaa
tacaacccgacagccggcgaatttagagaaatccaagtcgtttctgccatccctgatgat
tttacagataacagccagggaagcgcaatacatgtcacgcaggacggacgttttgtttat
gtcgcaaaccgcggccatgacagtatcgccgtatttgaagtgaatcaatattcaggagag
ctggctttcgtagaaagagtgtcgacagaaggaaactggcctcgtgactttgtatttgac
ccaacggaagggttcctcgttgcttcaaatgaagaaacaggcaaccttgtcttgtttgaa
agagacaaagaaaccggccgattgacactcctcccatcaacggtttctgtcccttacccg
gtttgtgtaaagtttttacatcaagtataa

DBGET integrated database retrieval system