KEGG   Bacillus subtilis subsp. subtilis 168: BSU13020Help
Entry
BSU13020          CDS       T00010                                 

Gene name
ykgA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidinotransf PAD_porph
Motif
Other DBs
NCBI-GeneID: 939864
NCBI-ProteinID: NP_389185
Pasteur: BG13235
BSORF: BG13235
UniProt: O34497
Position
complement(1371015..1371875)
Genome map
AA seq 286 aa AA seqDB search
MDVSIPKSQHKTVCRTEYGTLQKVILCKPEHMTIKDVINETQKHFEDDNIHVKTANDQHS
RLVEALRSHNVEVVLLPVRDGLPEQVFTRDIGFVIGEKAFLSSMTEPIRQGEEAVIKDFF
HSQGISYTRMLDTSIEGGDVIIDDDIVYVGISQRTDISAIGQLEEALPEYTIVPVKLHEK
FLHLDCVFNIISESEALIYSQAIEPDAADMLAKRYDLIEVPEDEQFTLGTNVLSIGKKTI
ISLPGNRHVNQQLSKRGYHIIEIDLSEIIKSGGSFRCCTMPLIRGE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggacgtatccatcccgaaatctcagcacaaaacggtatgccgaacggaatacggcaca
cttcaaaaagtgatcttatgcaaacctgagcacatgaccataaaagatgttataaacgaa
acacaaaaacattttgaagatgacaatattcatgtaaaaaccgctaacgaccagcacagc
cgcttagtggaggcacttaggtcacacaacgttgaggtcgtccttttgcccgttcgcgac
ggactcccagaacaggtttttactagggacataggatttgtcatcggagaaaaagccttt
ctgtcaagcatgactgaaccgattcgccaaggagaagaagccgttataaaagattttttt
cacagccaaggtatctcttacacccgcatgcttgatacgagtattgaaggcggagacgtc
attatcgatgatgacattgtctatgtcggaatcagccagcgcaccgacatttcagctatc
ggccagctagaagaggcacttcctgaatatacgatcgttccagtgaagcttcatgaaaaa
tttttgcatttggactgcgtatttaacattatatctgaaagcgaagcgttaatttattca
caggccattgagccagatgcagccgatatgctggcaaaacgttatgatcttattgaggtg
cccgaggacgaacaatttacgcttggcaccaacgtcctttcaatcggaaaaaaaacgatc
atcagtctccctggcaaccgccatgtcaatcaacagctatcgaaaagaggctatcacatt
atcgaaattgacctgtcagaaattattaaatcaggcggctccttcaggtgctgcacaatg
ccgctgattcgaggcgaatga

DBGET integrated database retrieval system