KEGG   Bacillus subtilis subsp. subtilis 168: BSU13030
Entry
BSU13030          CDS       T00010                                 

Gene name
ykhA
Definition
(RefSeq) acyl-CoA thioesterase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 4HBT
Other DBs
NCBI-GeneID: 937988
NCBI-ProteinID: NP_389186
Pasteur: BG11417
BSORF: BG11417
UniProt: P49851 A0A6M4JRA5
Position
1372035..1372553
AA seq 172 aa
METPETRFCKESKVVKTSRVFPLDTNNHNTLFGGKLMSYIDDIASISAARHCRRETVTAS
MDSVDFLKPIGQKDSVCLESYVTWVGTSSMEVFVKVIKEHLMTGERELAATSFLTFVALD
SNGKPVPVPRVVPETEEEIMLHNTAVQRANERKNRKRHSQALANALGTDKPW
NT seq 519 nt   +upstreamnt  +downstreamnt
atggaaacaccggaaacaagattttgtaaagagtcaaaggttgtgaaaaccagcagggtg
ttcccgcttgacacgaacaaccataatacgctgtttggcggaaaattaatgagctacata
gacgacattgcctctatttcagcggcgcgccattgcagacgtgaaacggtaacagcttca
atggattctgtagattttttaaagccgatcgggcaaaaggattctgtctgcctagagtca
tatgtgacatgggtcggcacatcttccatggaagtatttgtgaaagttattaaggagcat
ttgatgactggcgaacgggaactcgctgccacatcctttttgacatttgtcgcattagat
tcaaatggcaagccggtgcctgtaccgagggttgtaccggaaacagaagaagaaatcatg
ctgcataatacagctgtacagcgtgctaatgaacgtaagaaccgcaagagacacagccag
gcgcttgcaaatgcgctcggaactgataagccttggtga

DBGET integrated database retrieval system