KEGG   Bacillus subtilis subsp. subtilis 168: BSU13040Help
Entry
BSU13040          CDS       T00010                                 

Gene name
hmp
Definition
(RefSeq) flavohemoprotein
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     BSU13040 (hmp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 Globin FAD_binding_6 Protoglobin NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 939891
NCBI-ProteinID: NP_389187
Pasteur: BG11418
BSORF: BG11418
UniProt: P49852
Position
1372792..1373991
Genome map
AA seq 399 aa AA seqDB search
MLDNKTIEIIKSTVPVLQQHGETITGRFYDRMFQDHPELLNIFNQTNQKKKTQRTALANA
VIAAAANIDQLGNIIPVVKQIGHKHRSIGIKPEHYPIVGKYLLIAIKDVLGDAATPDIMQ
AWEKAYGVIADAFIGIEKDMYEQAEEQAGGWKEYKPFVIAKKERESKEITSFYLKPEDSK
PLPEFQAGQYISIKVRIPDSEYTHIRQYSLSDMPGKDYYRISVKKDGVVSSYLHDGLQEG
DSIEISAPAGDFVLDHASQKDLVLISAGVGITPMISMLKTSVSKQPERQILFIHAAKNSE
YHALRHEVEEAAKHSAVKTAFVYREPTEEDRAGDLHFHEGQIDQQFLKELIANTDADYYI
CGSPSFITAMHKLVSELGSAPESIHYELFGPQLSLAQSV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaaaacaatcgaaattattaaaagcactgtacccgtattgcaacagcat
ggagaaacaatcactggccgtttttacgatcggatgtttcaagaccatccagagcttttg
aacatttttaatcaaacaaaccaaaagaaaaaaacacagcgaactgcactggcaaatgcc
gttattgcagctgcggcaaacattgaccaattaggaaacatcattccggttgtcaaacaa
atcggccacaagcaccgcagtatcggaattaagcctgagcactacccaatcgtcggtaaa
tatttgctgattgcgattaaagatgtattgggagacgctgcaactcctgacattatgcag
gcatgggaaaaagcgtacggagtcattgctgacgcgttcatcggaattgaaaaagacatg
tatgaacaggctgaagagcaagccggcggctggaaggagtataagccattcgttatcgca
aaaaaagagcgggaaagcaaagaaattacatccttctatttgaaaccggaagacagcaag
ccgttacctgaattccaagcagggcaatatatcagcatcaaagtgcggattcctgattct
gaatatacgcatatccgccagtacagcctgtctgatatgccgggaaaagactattatcga
atttcagtgaagaaagatggtgtcgtgtcttcctacttacacgatgggctgcaggaggga
gattcaatagagatcagcgcaccggcaggggactttgttttagatcatgcatcacaaaaa
gatctcgttttgatcagtgccggagttggcattacaccaatgatcagcatgctgaaaaca
tctgtttccaaacagcctgaacggcaaattctgttcattcatgcggcgaaaaacagtgaa
tatcatgcattgcgccatgaagtagaagaagcagcaaaacattctgctgttaaaacagca
tttgtgtatcgcgagccgacagaggaagaccgtgcaggtgatctgcattttcatgaagga
cagattgatcagcaattcctcaaagaactgattgccaacacagatgcggattactatatt
tgcggttcaccgtcgtttattacggcaatgcataagcttgtatcagagctcggatcagcg
ccggagtctatccattacgagctattcggcccgcaattaagtttggcgcagtccgtttga

DBGET integrated database retrieval system