KEGG   Bacillus subtilis subsp. subtilis 168: BSU13040
Entry
BSU13040          CDS       T00010                                 

Symbol
hmp
Name
(RefSeq) flavohemoprotein
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU13040 (hmp)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     BSU13040 (hmp)
SSDB
Motif
Pfam: NAD_binding_1 Globin FAD_binding_6 NAD_binding_6 Protoglobin PAH
Other DBs
NCBI-GeneID: 939891
NCBI-ProteinID: NP_389187
Pasteur: BG11418
BSORF: BG11418
UniProt: P49852 A0A6M3ZF63
Position
1372792..1373991
AA seq 399 aa
MLDNKTIEIIKSTVPVLQQHGETITGRFYDRMFQDHPELLNIFNQTNQKKKTQRTALANA
VIAAAANIDQLGNIIPVVKQIGHKHRSIGIKPEHYPIVGKYLLIAIKDVLGDAATPDIMQ
AWEKAYGVIADAFIGIEKDMYEQAEEQAGGWKEYKPFVIAKKERESKEITSFYLKPEDSK
PLPEFQAGQYISIKVRIPDSEYTHIRQYSLSDMPGKDYYRISVKKDGVVSSYLHDGLQEG
DSIEISAPAGDFVLDHASQKDLVLISAGVGITPMISMLKTSVSKQPERQILFIHAAKNSE
YHALRHEVEEAAKHSAVKTAFVYREPTEEDRAGDLHFHEGQIDQQFLKELIANTDADYYI
CGSPSFITAMHKLVSELGSAPESIHYELFGPQLSLAQSV
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgttagataacaaaacaatcgaaattattaaaagcactgtacccgtattgcaacagcat
ggagaaacaatcactggccgtttttacgatcggatgtttcaagaccatccagagcttttg
aacatttttaatcaaacaaaccaaaagaaaaaaacacagcgaactgcactggcaaatgcc
gttattgcagctgcggcaaacattgaccaattaggaaacatcattccggttgtcaaacaa
atcggccacaagcaccgcagtatcggaattaagcctgagcactacccaatcgtcggtaaa
tatttgctgattgcgattaaagatgtattgggagacgctgcaactcctgacattatgcag
gcatgggaaaaagcgtacggagtcattgctgacgcgttcatcggaattgaaaaagacatg
tatgaacaggctgaagagcaagccggcggctggaaggagtataagccattcgttatcgca
aaaaaagagcgggaaagcaaagaaattacatccttctatttgaaaccggaagacagcaag
ccgttacctgaattccaagcagggcaatatatcagcatcaaagtgcggattcctgattct
gaatatacgcatatccgccagtacagcctgtctgatatgccgggaaaagactattatcga
atttcagtgaagaaagatggtgtcgtgtcttcctacttacacgatgggctgcaggaggga
gattcaatagagatcagcgcaccggcaggggactttgttttagatcatgcatcacaaaaa
gatctcgttttgatcagtgccggagttggcattacaccaatgatcagcatgctgaaaaca
tctgtttccaaacagcctgaacggcaaattctgttcattcatgcggcgaaaaacagtgaa
tatcatgcattgcgccatgaagtagaagaagcagcaaaacattctgctgttaaaacagca
tttgtgtatcgcgagccgacagaggaagaccgtgcaggtgatctgcattttcatgaagga
cagattgatcagcaattcctcaaagaactgattgccaacacagatgcggattactatatt
tgcggttcaccgtcgtttattacggcaatgcataagcttgtatcagagctcggatcagcg
ccggagtctatccattacgagctattcggcccgcaattaagtttggcgcagtccgtttga

DBGET integrated database retrieval system