KEGG   Bacillus subtilis subsp. subtilis 168: BSU13050
Entry
BSU13050          CDS       T00010                                 

Gene name
ykzH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Zincin_2 DUF4726
Other DBs
NCBI-GeneID: 937994
NCBI-ProteinID: NP_389188
Pasteur: BG13336
BSORF: BG13336
UniProt: O31653 A0A6M4JMB2
Position
complement(1374068..1374292)
AA seq 74 aa
MKNQKSNTLWPFDLPLAPQPEGYQQQTIDRLAGLELRMKQLIRAIEVNNELLRTMQEQQN
RVCTNGSGSVIVRM
NT seq 225 nt   +upstreamnt  +downstreamnt
atgaaaaatcagaagtcgaataccctttggccctttgatctgccattggctccccaaccc
gagggctaccagcagcaaacaatcgacaggctggccggtttggagctaagaatgaagcaa
ctaattagagcgattgaggtaaacaatgaattgctgagaacaatgcaagaacagcaaaac
cgtgtatgcacaaatggcagcgggtctgtgattgtccggatgtag

DBGET integrated database retrieval system