KEGG   Bacillus subtilis subsp. subtilis 168: BSU13070Help
Entry
BSU13070          CDS       T00010                                 

Gene name
ykkA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB_2 DUF664 DinB HflK_N
Motif
Other DBs
NCBI-GeneID: 937079
NCBI-ProteinID: NP_389190
Pasteur: BG11420
BSORF: BG11420
UniProt: P49854
Position
1375260..1375787
Genome map
AA seq 175 aa AA seqDB search
MKDLSIRNDMAPTVSLLYSAVEENSLRLASIVSHMTHSELYYKGRCQTKNSTAQLLHHIT
NVDIRWVWRIKENRIPDHIEQAYGPMTDESGRLPEPVNQPDLDELLKRHQHVVEKLKSVC
FTLTENALNQPLSFEGDTATIRWGIWHMADHNRYHQAHIEALKKEWKQDVAKYER
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttatccataagaaacgacatggcgccaacggtcagtttgctgtattccgca
gtggaagaaaacagtctccgtctggcttccatcgtaagccatatgacacacagtgaactt
tactataaggggcgctgccaaacaaaaaacagcacggctcagcttttgcaccatatcaca
aatgttgatatcagatgggtctggcgtatcaaggaaaatcggatcccggaccatattgaa
caggcatacggcccgatgacagatgaaagcggacggctgcctgaaccggtgaatcagcca
gacttagatgaactcctgaaaagacatcagcatgtagtagagaagctgaaatcggtatgc
ttcactttaactgaaaatgctttgaaccagccgctttccttcgaaggtgacaccgcgacg
atacgatggggaatttggcatatggcagatcataaccgctatcatcaggcacatattgaa
gctctcaaaaaagaatggaagcaggatgtggcgaagtatgaacgctaa

DBGET integrated database retrieval system