KEGG   Bacillus subtilis subsp. subtilis 168: BSU13080
Entry
BSU13080          CDS       T00010                                 

Symbol
ykkB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_8 FR47
Other DBs
NCBI-GeneID: 939859
NCBI-ProteinID: NP_389191
Pasteur: BG11421
BSORF: BG11421
UniProt: P49855 A0A6M3Z9R5
Position
1375777..1376295
AA seq 172 aa
MNAKTKLVTDRIRLRCMEDRDQATLFGLLFNDPDVMTYYSGLKDKRQTREWVNWNQRNEK
GYGVSLWIAEDKRTGEFLGQCGIVPQQIENQTVMEIGYMFARRHWGNGYAQEAARACLDY
GFNERQFGKMAALIDPGNKASIRVAEKIGMHYSKTIRKWNKPIAVYERKSYN
NT seq 519 nt   +upstreamnt  +downstreamnt
atgaacgctaaaacgaagcttgtgactgatcgaattcgtttgcgctgtatggaagatcgg
gatcaagccactttgtttgggctgctttttaatgatcctgacgtcatgacatattattcc
ggtttaaaagataagaggcaaacccgcgagtgggtcaattggaaccaacgaaatgaaaaa
gggtacggcgttagtctgtggatcgccgaagataagcggacaggggagtttttggggcaa
tgcggcatcgttccccagcagatcgaaaatcaaaccgtaatggaaattggctatatgttt
gcccgccgccactgggggaacggctatgcgcaagaagcggctcgggcctgtctggactat
ggctttaacgagcggcagttcggcaaaatggcggctttgattgatccgggtaacaaagcg
tccatacgggtagcggagaaaatcggcatgcattacagcaaaacgatcagaaaatggaat
aaaccgatcgcggtatatgaaagaaaatcttacaattga

DBGET integrated database retrieval system