KEGG   Bacillus subtilis subsp. subtilis 168: BSU13090
Entry
BSU13090          CDS       T00010                                 

Symbol
ykkC
Name
(RefSeq) multidrug resistance protein
  KO
K18924  paired small multidrug resistance pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13090 (ykkC)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU13090 (ykkC)
SSDB
Motif
Pfam: Multi_Drug_Res BaxI_1 EamA
Other DBs
NCBI-GeneID: 936835
NCBI-ProteinID: NP_389192
Pasteur: BG11422
BSORF: BG11422
UniProt: P49856 A0A6M3Z9W7
Position
1376517..1376855
AA seq 112 aa
MKWGLVVLAAVFEVVWVIGLKHADSALTWSGTAIGIIFSFYLLMKATHSLPVGTVYAVFT
GLGTAGTVLSEIVLFHEPVGWPKLLLIGVLLIGVIGLKLVTQDETEEKGGEA
NT seq 339 nt   +upstreamnt  +downstreamnt
atgaaatggggattggtcgtgcttgccgctgttttcgaggttgtttgggtgataggctta
aagcacgctgactcagccttaacatggagcggcactgccatcggcatcatattcagcttt
taccttctaatgaaggcgactcacagtctgcctgttggtaccgtgtatgccgtctttacc
gggctcggcacagcgggaacagtacttagtgaaatcgttctttttcatgaaccggttgga
tggccgaagctattgttaattggcgtgctcttaatcggtgtaatcgggttgaagcttgtg
acacaggatgagacagaggaaaaaggaggcgaggcataa

DBGET integrated database retrieval system