KEGG   Bacillus subtilis subsp. subtilis 168: BSU13100
Entry
BSU13100          CDS       T00010                                 

Gene name
ykkD
Definition
(RefSeq) multidrug resistance protein
  KO
K18925  paired small multidrug resistance pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13100 (ykkD)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU13100 (ykkD)
SSDB
Motif
Pfam: Multi_Drug_Res EamA 7TMR-DISM_7TM EmrE DUF4131 Bax1-I DUF543
Other DBs
NCBI-GeneID: 938109
NCBI-ProteinID: NP_389193
Pasteur: BG11423
BSORF: BG11423
UniProt: P49857
Position
1376855..1377172
AA seq 105 aa
MLHWISLLCAGCLEMAGVALMNQYAKEKSVKWVLLIIVGFAASFSLLSYAMETTPMGTAY
AVWTGIGTAGGALIGILFYKEQKDAKRIFFIALILCSAVGLKILS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgctgcactggatcagtttattgtgcgcgggctgtttagaaatggccggcgtggccctt
atgaatcaatatgcgaaagaaaaaagcgtgaaatgggtgctgttgatcattgttggtttt
gccgcttcattttccttgctgtcgtacgcaatggaaaccactccgatgggaacggcttac
gcggtctggacaggaattggcaccgccggcggggcgcttatcggcatcctcttttacaag
gagcagaaagacgccaaacggatcttctttatcgcgttgattttatgctcagcagttggt
ttaaaaattctgtcataa

DBGET integrated database retrieval system