KEGG   Bacillus subtilis subsp. subtilis 168: BSU13100
Entry
BSU13100          CDS       T00010                                 

Symbol
ykkD
Name
(RefSeq) multidrug resistance protein
  KO
K18925  paired small multidrug resistance pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13100 (ykkD)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU13100 (ykkD)
SSDB
Motif
Pfam: Multi_Drug_Res EamA 7TMR-DISM_7TM DUF6541 EmrE DUF4131 Bax1-I Phage_holin_3_7 DUF543
Other DBs
NCBI-GeneID: 938109
NCBI-ProteinID: NP_389193
Pasteur: BG11423
BSORF: BG11423
UniProt: P49857 A0A6M3Z9V7
Position
1376855..1377172
AA seq 105 aa
MLHWISLLCAGCLEMAGVALMNQYAKEKSVKWVLLIIVGFAASFSLLSYAMETTPMGTAY
AVWTGIGTAGGALIGILFYKEQKDAKRIFFIALILCSAVGLKILS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgctgcactggatcagtttattgtgcgcgggctgtttagaaatggccggcgtggccctt
atgaatcaatatgcgaaagaaaaaagcgtgaaatgggtgctgttgatcattgttggtttt
gccgcttcattttccttgctgtcgtacgcaatggaaaccactccgatgggaacggcttac
gcggtctggacaggaattggcaccgccggcggggcgcttatcggcatcctcttttacaag
gagcagaaagacgccaaacggatcttctttatcgcgttgattttatgctcagcagttggt
ttaaaaattctgtcataa

DBGET integrated database retrieval system